DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL4 and CG31248

Sequence 1:NP_611406.1 Gene:AANATL4 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001262333.1 Gene:CG31248 FlyBaseID:FBgn0051248 Length:251 Species:Drosophila melanogaster

Alignment Length:222 Identity:42/223 (19%)
Similarity:93/223 (42%) Gaps:30/223 (13%)


  Fly     4 TTIDG-VTIRIMRPEDYAQVKAYMEAEYYTSEPLCQSS--GEPVHQQNE-EINDAFNQSIIAEGT 64
            |..|| ..:|.:...|..:....::..::.:|.:|.:.  ..|.::|.. ::.:...::.: :|.
  Fly    11 TLHDGKFEVRSVTHSDLEEALDVLDGSFFLNESVCVACEINLPENRQARLDLRELCRKTAL-DGV 74

  Fly    65 SLLALDENDGGRIVGLVLACASY--PDNVNAGTLNLKLENVEDNAWGRMYHLLMKAKREVN---L 124
            ||| :.|.|.||:|.:......|  |...:...|..:.|.|:.....|:...:::....::   :
  Fly    75 SLL-VKEADTGRVVSVSFNKIQYAPPPGEDHFFLKFRNEEVKSPQARRLMDFMIEVDGRIDVCAM 138

  Fly   125 FERYDIPKALYSHVTSVASWKRGKGLGSRLAATLMELG----------------RSNGFPLMMAF 173
            |......:.::  :.::.|.:| .|||..|:...:||.                ||.....:.|.
  Fly   139 FNMVCFCELMF--LATLPSHER-LGLGRSLSQFTIELTKELAEGKGLEDIDDKLRSKRPAAVTAL 200

  Fly   174 CTSFYSARQKGALGMECIYSIDYADYK 200
            .||.:|.:...|...:.|.::.|::::
  Fly   201 WTSRFSQKVGKATDFKVINTVSYSEFE 227



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1342759
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.