DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL4 and speck

DIOPT Version :9

Sequence 1:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_995934.1 Gene:speck / 37867 FlyBaseID:FBgn0287831 Length:275 Species:Drosophila melanogaster


Alignment Length:224 Identity:62/224 - (27%)
Similarity:102/224 - (45%) Gaps:31/224 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TIRIMRPEDYAQVKAYMEAEYYTSEPL--------CQSSGEPVHQQNEEINDAFNQSIIAEGTSL 66
            ||.:::|||...|.|.::..::..|||        |:..            :.::...:.:..|.
  Fly    58 TIELIQPEDGEAVIAMLKTFFFKDEPLNTFLDLGECKEL------------EKYSLKPLPDNCSY 110

  Fly    67 LALDENDGGRIVGLV---LACASYPDNVNAGTLNLKLENVEDNAWGRMYHLLMKAKREVNLFERY 128
            .|:  |..|.|:|:.   |.....||:|.    ....::.|...:.::..|:...:.:.|:|:.|
  Fly   111 KAV--NKKGEIIGVFLNGLMRRPSPDDVP----EKAADSCEHPKFKKILSLMDHVEEQFNIFDVY 169

  Fly   129 -DIPKALYSHVTSVASWKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALGMECIY 192
             |....|...:.||.:..||.|:..||.....|..|.||..:....|:|.||||....||...::
  Fly   170 PDEELILDGKILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVF 234

  Fly   193 SIDYADYKDDEGRVIFTPAAPHTKLRVMA 221
            .:.:|||| .:|.|:|.|||||..::|||
  Fly   235 RMQFADYK-PQGEVVFKPAAPHVGIQVMA 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL4NP_611406.1 None
speckNP_995934.1 RimI 181..250 CDD:440224 25/69 (36%)


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.