DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL4 and AANAT1

Sequence 1:NP_611406.1 Gene:AANATL4 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_995934.1 Gene:AANAT1 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster

Alignment Length:224 Identity:62/225 (28%)
Similarity:102/225 (45%) Gaps:31/225 (14%)


  Fly    10 TIRIMRPEDYAQVKAYMEAEYYTSEPL--------CQSSGEPVHQQNEEINDAFNQSIIAEGTSL 66
            ||.:::|||...|.|.::..::..|||        |:..            :.::...:.:..|.
  Fly    58 TIELIQPEDGEAVIAMLKTFFFKDEPLNTFLDLGECKEL------------EKYSLKPLPDNCSY 110

  Fly    67 LALDENDGGRIVGLV---LACASYPDNVNAGTLNLKLENVEDNAWGRMYHLLMKAKREVNLFERY 128
            .|:  |..|.|:|:.   |.....||:|.    ....::.|...:.::..|:...:.:.|:|:.|
  Fly   111 KAV--NKKGEIIGVFLNGLMRRPSPDDVP----EKAADSCEHPKFKKILSLMDHVEEQFNIFDVY 169

  Fly   129 -DIPKALYSHVTSVASWKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALGMECIY 192
             |....|...:.||.:..||.|:..||.....|..|.||..:....|:|.||||....||...::
  Fly   170 PDEELILDGKILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVF 234

  Fly   193 SIDYADYKDDEGRVIFTPAAPHTKLRVMA 221
            .:.:|||| .:|.|:|.|||||..::|||
  Fly   235 RMQFADYK-PQGEVVFKPAAPHVGIQVMA 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL4NP_611406.1 None
AANAT1NP_995934.1 RimI <168..235 CDD:223532 22/67 (33%)
NAT_SF <183..227 CDD:302625 16/44 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1342090
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I3998
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001559
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
44.080

Return to query results.
Submit another query.