DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL4 and R05H10.7

Sequence 1:NP_611406.1 Gene:AANATL4 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001022271.1 Gene:R05H10.7 WormBaseID:WBGene00011046 Length:226 Species:Caenorhabditis elegans

Alignment Length:225 Identity:41/226 (18%)
Similarity:89/226 (39%) Gaps:35/226 (15%)


  Fly    12 RIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTSLLALDENDGGR 76
            |:.:..|...|..::...|:..|| |..:.:.:..:.|.:.::.....:....|.:...::  |.
 Worm     8 RLAKKSDAPDVLNFLLEHYFPLEP-CTRALKLIKSEAEVLYESLVARCLQFPFSTVVTTQS--GE 69

  Fly    77 IVG-LVLACASYPDNVNAG-------------TLNLKLENV-EDNAWGRMYHLLMKAKREVNLFE 126
            ||. ||.:.....||...|             |..:|:.|. .::.|.       .|.:.:|:  
 Worm    70 IVACLVNSAWKRDDNAVEGADYEVDEGLTENMTAFIKMLNTCHEDFWN-------LAPQNINV-- 125

  Fly   127 RYDIPKALYSHVTSVASWKRGKGLGSRLAATLMELGRSNGFPL--MMAFCTSFYSARQKGALGME 189
                  .|:..|:||:...:.:|:.:::..|.|...:.:.:.:  :::...||.:.......|.:
 Worm   126 ------VLHREVSSVSEKYQRRGIATKMLTTNMPKAKLDEYSIDGVLSETCSFGNQVLLEKHGFK 184

  Fly   190 CIYSIDYADYKDDEGRVIFTPAAPHTKLRV 219
            |:.:|.|....|.:|..|.......|:|::
 Worm   185 CLKTIPYTGIVDSQGNQILKTDDGSTELKL 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL4NP_611406.1 None
R05H10.7NP_001022271.1 Acetyltransf_7 <134..184 CDD:316066 7/50 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I3998
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 1 0.910 0.692 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.