| Sequence 1: | NP_611406.1 | Gene: | AANATL4 / 37213 | FlyBaseID: | FBgn0034429 | Length: | 224 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001022271.1 | Gene: | R05H10.7 / 3565038 | WormBaseID: | WBGene00011046 | Length: | 226 | Species: | Caenorhabditis elegans | 
| Alignment Length: | 225 | Identity: | 41/225 - (18%) | 
|---|---|---|---|
| Similarity: | 89/225 - (39%) | Gaps: | 35/225 - (15%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    12 RIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTSLLALDENDGGR 76 
  Fly    77 IVG-LVLACASYPDNVNAG-------------TLNLKLENV-EDNAWGRMYHLLMKAKREVNLFE 126 
  Fly   127 RYDIPKALYSHVTSVASWKRGKGLGSRLAATLMELGRSNGFPL--MMAFCTSFYSARQKGALGME 189 
  Fly   190 CIYSIDYADYKDDEGRVIFTPAAPHTKLRV 219 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| AANATL4 | NP_611406.1 | None | |||
| R05H10.7 | NP_001022271.1 | Acetyltransf_7 | <134..184 | CDD:316066 | 7/49 (14%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C160155937 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 57 | 1.000 | Inparanoid score | I4040 | 
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1185856at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR20905 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 6 | 6.000 | |||||