DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL4 and AANATL3

Sequence 1:NP_611406.1 Gene:AANATL4 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_610018.1 Gene:AANATL3 FlyBaseID:FBgn0032839 Length:222 Species:Drosophila melanogaster

Alignment Length:224 Identity:129/225 (57%)
Similarity:169/225 (75%) Gaps:2/225 (1%)


  Fly     1 MTPTTIDGVTIRIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTS 65
            |..:..||:|||.|..|||..|||:::..::.|||||||:.|.|..|||:.||.::.|:||:||.
  Fly     1 MASSIKDGITIRTMTKEDYPSVKAFLKDNFFQSEPLCQSTSENVQSQNEKENDEYHLSMIAQGTC 65

  Fly    66 LLALDENDGGRIVGLVLACASYPDNVNAGTLNLKLENVEDNAWGRMYHLLMKAKREVNLFERYDI 130
            |:|:||::||:.||||||.|.||:::...  .::.|::|.:.|.|...:|.|.:||.|||||:.|
  Fly    66 LVAIDESNGGKFVGLVLAGAQYPEDLEKH--RIEAESMEQHFWARACIMLSKIEREANLFERFGI 128

  Fly   131 PKALYSHVTSVASWKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALGMECIYSID 195
            .|.||||:|||.|..||||||||||||||::||:.|||.|.|:||||||||||.||||:|::|:.
  Fly   129 SKLLYSHITSVESSMRGKGLGSRLAATLMDVGRAKGFPAMTAYCTSFYSARQKEALGMKCVHSLP 193

  Fly   196 YADYKDDEGRVIFTPAAPHTKLRVMAIKL 224
            |||||||:||.|||||.|||..|:|.|||
  Fly   194 YADYKDDQGRPIFTPAEPHTMARIMFIKL 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL4NP_611406.1 None
AANATL3NP_610018.1 NAT_SF <122..182 CDD:302625 45/60 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1341621
eggNOG 1 0.900 E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.