DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL4 and CG31493

DIOPT Version :10

Sequence 1:NP_611406.1 Gene:AANATL4 / 37213 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_731135.2 Gene:CG31493 / 318765 FlyBaseID:FBgn0051493 Length:246 Species:Drosophila melanogaster


Alignment Length:49 Identity:14/49 - (28%)
Similarity:22/49 - (44%) Gaps:9/49 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 RYDIPKALYSHVTSVASWKRGKGLG---------SRLAATLMELGRSNG 166
            |.:.|:|:.:..||.:|...|:.||         |.|.:....:..|||
  Fly   183 RIERPQAIVAITTSQSSQIMGRQLGMKTMHKWHFSELRSLCGAMAESNG 231

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
AANATL4NP_611406.1 None