DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL4 and W02D7.4

Sequence 1:NP_611406.1 Gene:AANATL4 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_505142.1 Gene:W02D7.4 WormBaseID:WBGene00020940 Length:232 Species:Caenorhabditis elegans

Alignment Length:202 Identity:35/203 (17%)
Similarity:83/203 (41%) Gaps:15/203 (7%)


  Fly    12 RIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTSLLALDENDGGR 76
            |:.:|:|:.::..:::..:...|| |..:.:...:.:..:..|.....:....|.:.|.||  |.
 Worm    15 RVAQPKDHERIIKFLDKHFAKEEP-CSRALKISPEISRGVFTATVTRCLTTPFSTVVLQEN--GD 76

  Fly    77 IVGLVLACASYPDNVNAGTLNLKLENVEDNAWGRMYHLLMKAKREVNL-FERYDIPKA---LYSH 137
            :...:||      :|...|..|:..:.:|......:.|.::...:.:| |.:...|..   ::..
 Worm    77 LAACLLA------SVWNRTDPLENADFDDTGLPENFKLFIQFLNKAHLNFWKIAPPNVNSIIHRE 135

  Fly   138 VTSVASWKRGKGLGSRLAATLMELGRSNGFPL--MMAFCTSFYSARQKGALGMECIYSIDYADYK 200
            :.|||......|:.:::..|.|.......:.:  :::..||..:.......|.:|:..:.|:...
 Worm   136 IGSVAPQFTRLGIATKMVTTNMTKRNLKKYNIGGVLSETTSLANQIVLEKAGFKCLKELPYSTIV 200

  Fly   201 DDEGRVI 207
            |.:|..:
 Worm   201 DSKGNQV 207



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I3998
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 1 0.910 0.714 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.