DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL4 and M7.12

Sequence 1:NP_611406.1 Gene:AANATL4 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_502070.2 Gene:M7.12 WormBaseID:WBGene00010887 Length:241 Species:Caenorhabditis elegans

Alignment Length:83 Identity:15/84 (18%)
Similarity:36/84 (43%) Gaps:8/84 (10%)


  Fly     3 PTTIDGVTIRIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFN---QSIIAEGT 64
            |.:.:......::.::..:|..::...:...|||.:::|    ....:|...|:   :.::....
 Worm    18 PASTEKYYFETVKHDNRNEVVDFLNNNFRVEEPLSKAAG----MTESDIQSCFDGVFERVLKNEV 78

  Fly    65 SLLALDENDGGRIVGLVL 82
            |:||..: ....|||.:|
 Worm    79 SILARSK-QSDEIVGCML 95



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2E94Y
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I3998
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 1 0.910 0.865 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.