DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL4 and R05H10.1

Sequence 1:NP_611406.1 Gene:AANATL4 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_497076.1 Gene:R05H10.1 WormBaseID:WBGene00011042 Length:250 Species:Caenorhabditis elegans

Alignment Length:232 Identity:43/233 (18%)
Similarity:80/233 (34%) Gaps:54/233 (23%)


  Fly    12 RIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTSLLAL------D 70
            |.....|:.::..::...:|..||..::|...:    ||....|.:..    ||.|.|      .
 Worm     8 RTAEKSDFDRILKFLAEHFYHEEPSIRASKIAL----EEWLPIFGEMT----TSSLKLPISTVVT 64

  Fly    71 ENDGGRIVGLVLACASYPDNVNAGTLNLKLENVEDNAWGRMYH---------------------L 114
            ..||              :|:.|..||......||..  ||.|                     :
 Worm    65 TEDG--------------ENIVAVLLNSMWSREEDEE--RMKHGNGKGDHDTSGYSEALQRFMTI 113

  Fly   115 LMKAKREVNLFERYDIPKALYSHVTSVAS-WKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFY 178
            :.|...|.......|:...:|..::||.. |:| :|:.:::.:..|...|.:....:::..:||.
 Worm   114 VQKCHDEFWNLAPSDVNLVVYREISSVGKPWQR-QGIATKMLSRNMSAARLHNVDGIVSATSSFA 177

  Fly   179 SARQKGALGMECIYSIDYADYKDDEG-RVIFTPAAPH 214
            :.......|.:|:....|:......| :::.|....|
 Worm   178 NQTLLAKNGFQCLKEFPYSGIVSSNGDKLVETDDGSH 214



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1342510
eggNOG 1 0.900 E1_2E94Y
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I3998
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 1 0.910 0.700 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.