DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL6 and AANATL4

Sequence 1:NP_611405.2 Gene:AANATL6 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_611406.1 Gene:AANATL4 FlyBaseID:FBgn0034429 Length:224 Species:Drosophila melanogaster

Alignment Length:218 Identity:86/219 (39%)
Similarity:130/219 (59%) Gaps:2/219 (1%)


  Fly     7 DGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYLAVIRQGLSIVALDD 71
            ||:|:|:|:.:||.:||.:|...::..||:.....||:|.|:||..|....::|.:|.|::|||:
  Fly     7 DGVTIRIMRPEDYAQVKAYMEAEYYTSEPLCQSSGEPVHQQNEEINDAFNQSIIAEGTSLLALDE 71

  Fly    72 NNGGLLVG--IAVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVSSYLSL 134
            |:||.:||  :|.|...|.:.....:.:.|.:|.||.||....:.|.:||.|:|||:.:...|..
  Fly    72 NDGGRIVGLVLACASYPDNVNAGTLNLKLENVEDNAWGRMYHLLMKAKREVNLFERYDIPKALYS 136

  Fly   135 LVISVHPSMRQRGILVILSKCLFKLGRLRGHTLFITSGTNHYSSRSAMKAGCECIHSVAYADYKD 199
            .|.||....|.:|:...|:..|.:|||..|..|.:...|:.||:|.....|.|||:|:.||||||
  Fly   137 HVTSVASWKRGKGLGSRLAATLMELGRSNGFPLMMAFCTSFYSARQKGALGMECIYSIDYADYKD 201

  Fly   200 ELGRPIYNPPAPHTHIRVLASKM 222
            :.||.|:.|.||||.:||:|.|:
  Fly   202 DEGRVIFTPAAPHTKLRVMAIKL 224



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1341678
eggNOG 1 0.900 E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.