DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL6 and AANATL2

Sequence 1:NP_611405.2 Gene:AANATL6 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001285667.1 Gene:AANATL2 FlyBaseID:FBgn0031791 Length:216 Species:Drosophila melanogaster

Alignment Length:216 Identity:72/217 (33%)
Similarity:118/217 (54%) Gaps:5/217 (2%)


  Fly     9 ITVRVMKEDDYPRVKTFMTDYFHYDEP-MGMGLEEPIHLQHEEEVDRQYLAVIRQGLSIVALDDN 72
            ||:|.|...||..|:.|:..:|...|| |.:..|:|...:........:.::|.|.||:||:|  
  Fly     4 ITIRAMTIGDYEEVEAFLAVHFFKQEPLMLIPQEDPKQSEVSSAEAELHRSLIPQDLSLVAVD-- 66

  Fly    73 NGGLLVGIAVAETMDPIEMAKQHKEAEEMEPNA-LGRSRKFIAKVEREANIFERFGVSSYLSLLV 136
             |..:||:.:|..:.|.::.::::|||:.|... |.:..||:|.:||:||||:.:||...|.|.:
  Fly    67 -GERIVGVVLAGELVPEDLEREYQEAEQKEITCLLDKIHKFLAGIERQANIFKHYGVERALYLYM 130

  Fly   137 ISVHPSMRQRGILVILSKCLFKLGRLRGHTLFITSGTNHYSSRSAMKAGCECIHSVAYADYKDEL 201
            :.|..|:|::.:...|.:...:|||.||..:..::.:|..|.|.......|||.:..|||||||.
  Fly   131 LGVDVSIRRQRVGTRLVEATIELGRQRGFPVVTSTCSNQNSKRLMTALNMECILTKDYADYKDEH 195

  Fly   202 GRPIYNPPAPHTHIRVLASKM 222
            |..:.....|||...|:|.::
  Fly   196 GEIVLRASEPHTSASVVAIRL 216

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL6NP_611405.2 None
AANATL2NP_001285667.1 NAT_SF 114..163 CDD:173926 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1341787
eggNOG 1 0.900 E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.