DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL6 and AgmNAT

Sequence 1:NP_611405.2 Gene:AANATL6 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_572268.1 Gene:AgmNAT FlyBaseID:FBgn0029813 Length:216 Species:Drosophila melanogaster

Alignment Length:211 Identity:57/212 (27%)
Similarity:99/212 (47%) Gaps:8/212 (4%)


  Fly     7 DGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQY-LAVIRQGLSIVALD 70
            |.|.||.:...:..::.||:..:::.:||:..|...|    ..|..|::: |:.:..|...|||.
  Fly     7 DDIVVRQVDVGETEQLMTFLLAHYYPEEPLTAGTHPP----EPEAADKEFLLSNVPFGTCFVALH 67

  Fly    71 DNNGGLLVGIAVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVSSYLSLL 135
            :   |.:|...||...|..|.....:||.:......|.....::.||...::..||.|.|.|.:.
  Fly    68 E---GRIVAAVVAGPKDSHEPEHMAEEARKYAGGKWGSILHLLSAVETATDVCRRFSVPSCLHVH 129

  Fly   136 VISVHPSMRQRGILVILSKCLFKLGRLRGHTLFITSGTNHYSSRSAMKAGCECIHSVAYADYKDE 200
            .:.|.|.:|.|.:...|.:.:.:.||..||.|.....|:.||:|...:.|.:.|:::.|.|:.|.
  Fly   130 ALGVDPQLRGRNLGGRLMETVAQRGRDLGHQLVSVDCTSVYSARLVQRLGYQLINTLRYVDHLDA 194

  Fly   201 LGRPIYNPPAPHTHIR 216
            .|:.:..||.||..::
  Fly   195 SGQQVIRPPPPHESVQ 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL6NP_611405.2 None
AgmNATNP_572268.1 Acetyltransf_1 33..180 CDD:306954 42/154 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1341881
eggNOG 1 0.900 E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.