DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL6 and W02D7.4

Sequence 1:NP_611405.2 Gene:AANATL6 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_505142.1 Gene:W02D7.4 WormBaseID:WBGene00020940 Length:232 Species:Caenorhabditis elegans

Alignment Length:222 Identity:50/223 (22%)
Similarity:94/223 (42%) Gaps:32/223 (14%)


  Fly     1 MILS---QNDGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLE-EPIHLQHEEEVDR-QYLAVI 60
            |:||   :|..:..||.:..|:.|:..|:..:|..:||....|: .|       |:.| .:.|.:
 Worm     1 MMLSKVLRNSPLLFRVAQPKDHERIIKFLDKHFAKEEPCSRALKISP-------EISRGVFTATV 58

  Fly    61 RQGL----SIVALDDNNGGLLVGI--AVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVERE 119
            .:.|    |.|.|.: ||.|...:  :|....||:|.|       :.:...|..:.|...:...:
 Worm    59 TRCLTTPFSTVVLQE-NGDLAACLLASVWNRTDPLENA-------DFDDTGLPENFKLFIQFLNK 115

  Fly   120 ANI-FERF---GVSSYLSLLVISVHPSMRQRGILVILSKCLFKLGRLRGHTL-FITSGTNHYSSR 179
            |:: |.:.   .|:|.:...:.||.|...:.||...:.........|:.:.: .:.|.|...:::
 Worm   116 AHLNFWKIAPPNVNSIIHREIGSVAPQFTRLGIATKMVTTNMTKRNLKKYNIGGVLSETTSLANQ 180

  Fly   180 SAM-KAGCECIHSVAYADYKDELGRPI 205
            ..: |||.:|:..:.|:...|..|..:
 Worm   181 IVLEKAGFKCLKELPYSTIVDSKGNQV 207



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.