DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL6 and M7.12

Sequence 1:NP_611405.2 Gene:AANATL6 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_502070.2 Gene:M7.12 WormBaseID:WBGene00010887 Length:241 Species:Caenorhabditis elegans

Alignment Length:143 Identity:31/144 (22%)
Similarity:60/144 (42%) Gaps:15/144 (10%)


  Fly    14 MKEDDYPRVKTFMTDYFHYDEPM--GMGLEEPIHLQHEEEVDRQYLAVIRQGLSIVALDDNNGGL 76
            :|.|:...|..|:.:.|..:||:  ..|:.|.   ..:...|..:..|::..:||:|....:.. 
 Worm    29 VKHDNRNEVVDFLNNNFRVEEPLSKAAGMTES---DIQSCFDGVFERVLKNEVSILARSKQSDE- 89

  Fly    77 LVGIAVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREAN-IFERF-----GVSSYLSLL 135
            :||..:.......:..|...|||:.|   .|..||.:..:....| :.|.|     ...:.|...
 Worm    90 IVGCMLNSVWKRNDPKKNEDEAEDFE---FGGDRKGVMTIGEILNELHESFWKLRPDQHTVLHFE 151

  Fly   136 VISVHPSMRQRGI 148
            :.||:.:.:::|:
 Worm   152 ISSVNKNHQRQGL 164



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2E94Y
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 1 0.910 0.700 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.