DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL6 and M7.8

Sequence 1:NP_611405.2 Gene:AANATL6 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_502069.1 Gene:M7.8 WormBaseID:WBGene00010884 Length:230 Species:Caenorhabditis elegans

Alignment Length:159 Identity:29/160 (18%)
Similarity:63/160 (39%) Gaps:26/160 (16%)


  Fly     4 SQNDGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLE---EPIHLQHEEEVDRQYLAVIRQGLS 65
            |..|.....|::.::...:..|:.:.|..|||:....:   |.|....:..:||    .::...|
 Worm     7 SATDKYYFEVLRNEEKSEMLKFLLESFRVDEPLNRASKISCEEIEKCLDGALDR----ALKTESS 67

  Fly    66 IVALDDNNGGLLVGIAVAETMDPIE-MAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVS 129
            |:|...:... :||..:.......| :....:|.::.|.:.:.:....:|::..|.:       .
 Worm    68 ILARSQDTHE-IVGCMLNSVWRRDESLCTPGEEDKDFEFHTIRKEVAMVAEILNELH-------E 124

  Fly   130 SYLSLL----------VISVHPSMRQRGI 148
            |:.||.          :.||..:.|::|:
 Worm   125 SFWSLRPDQDVVLHFEISSVSVNHRRQGL 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL6NP_611405.2 None
M7.8NP_502069.1 Acetyltransf_1 82..193 CDD:306954 12/80 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.