DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL6 and T10B5.4

Sequence 1:NP_611405.2 Gene:AANATL6 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001300192.1 Gene:T10B5.4 WormBaseID:WBGene00020390 Length:237 Species:Caenorhabditis elegans

Alignment Length:193 Identity:37/194 (19%)
Similarity:69/194 (36%) Gaps:50/194 (26%)


  Fly    21 RVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYLAVIRQGLSIVALDDNNGGLLV---GIAV 82
            :|..|:.::|...||:...|.     ..||:|...::     .|::..|:|....:||   ...|
 Worm    16 QVHKFLVEHFRVMEPITTSLS-----CSEEDVAEFFV-----DLTMSGLEDEKSSILVFDGEEIV 70

  Fly    83 AETMDPIEMAKQHKEAEEMEP----NA-----------LGRSRKFIAKVEREANIFERFGVSSYL 132
            |..::.::......|:....|    ||           ..:...|:..:|::.: |.........
 Worm    71 AVCLNAVKECSFVSESTPFNPHWDFNAEITNGQYKHENANKLVAFVQVLEQDLS-FLTGNPKKVF 134

  Fly   133 SLLVISVHPSMRQRGILVILSKCLFKLGRLRGHTLFITSGTNHYSSRSAMKAGCECIHSVAYA 195
            .:.|:.|..:.:.:||               |..|.      ..|..:|:|..||.:.:||.|
 Worm   135 KIDVLCVSKACQGKGI---------------GRQLV------EKSLENAVKEDCEYVATVATA 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL6NP_611405.2 None
T10B5.4NP_001300192.1 NAT_SF 107..170 CDD:173926 14/85 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2E94Y
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.