DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL6 and anat-1

Sequence 1:NP_611405.2 Gene:AANATL6 FlyBaseID:FBgn0034428 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001076662.1 Gene:anat-1 WormBaseID:WBGene00015938 Length:285 Species:Caenorhabditis elegans

Alignment Length:239 Identity:50/240 (21%)
Similarity:79/240 (33%) Gaps:48/240 (20%)


  Fly    11 VRVMKEDDYPRVKTFMTDYFHYDEPMGMGL---EEPIHLQHEEEVDRQYLAVIRQGLSIVALDDN 72
            |..:||.:...:..|:.|.|...|.:...|   ::.|.|:....:.|..:....|..|...:.|.
 Worm    65 VESVKESNLEEIVQFLIDNFAQTEAILASLKIDDDKICLKELTVMLRDLVQDSLQCSSTCVIRDV 129

  Fly    73 NGGLLVGIAVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVSSYLS---- 133
            ....:.|||:|......:.......|.|.      |.::....||....:|.:..|..||:    
 Worm   130 TTRQIDGIALACKTSIFDKQIDRLCAYEF------REQRVRDAVEFLKYVFNKLDVMYYLNEHRL 188

  Fly   134 -----LLVISVHPSMRQRGILVILSKCLFKLGRL-------------RGHTLFITSGTNHYSSRS 180
                 :.::.|...:..|||...|...:....|.             |||.|             
 Worm   189 YKPVFVALVCVRKELWGRGIGTTLMNHVKSAARTDSSDGLISLCSNERGHKL------------- 240

  Fly   181 AMKAGCEC-IHSVAYADYKDELGRP--IYNPPAPHTHIRVLASK 221
             ||..|.. ..:|.|..:|.|..||  :..||.....:..:.||
 Worm   241 -MKTYCPTDFAAVRYDAFKGEHLRPPIVMRPPETFHSVYAMLSK 283

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL6NP_611405.2 None
anat-1NP_001076662.1 NAT_SF <192..221 CDD:173926 5/29 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.