DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL5 and CG31248

Sequence 1:NP_611403.1 Gene:AANATL5 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001262333.1 Gene:CG31248 FlyBaseID:FBgn0051248 Length:251 Species:Drosophila melanogaster

Alignment Length:224 Identity:41/225 (18%)
Similarity:89/225 (40%) Gaps:40/225 (18%)


  Fly     6 NDG-ITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYLA--VIRQGLSIV 67
            :|| ..||.:...|.......:...|..:|.:.:..|..:....:..:|.:.|.  ....|:|::
  Fly    13 HDGKFEVRSVTHSDLEEALDVLDGSFFLNESVCVACEINLPENRQARLDLRELCRKTALDGVSLL 77

  Fly    68 ALDDNNGGLLVGIAVAETMDPIEMAKQHKE--------AEEMEPNALGRSRKFIAKVEREANIFE 124
            ..:.:.|.:     |:.:.:.|:.|....|        .||::.....|...|:.:|:...::..
  Fly    78 VKEADTGRV-----VSVSFNKIQYAPPPGEDHFFLKFRNEEVKSPQARRLMDFMIEVDGRIDVCA 137

  Fly   125 RFGVSSYLSLLVISVHPSMRQRGILVILSKCLFKLGRLRGLRLFIGSG----------------T 173
            .|.:..:..|:.::..||..:.|:...||:...:|.:    .|..|.|                |
  Fly   138 MFNMVCFCELMFLATLPSHERLGLGRSLSQFTIELTK----ELAEGKGLEDIDDKLRSKRPAAVT 198

  Fly   174 NHYSSRSAMKAG----CECIHSVAYADYK 198
            ..::||.:.|.|    .:.|::|:|::::
  Fly   199 ALWTSRFSQKVGKATDFKVINTVSYSEFE 227



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1342732
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.