DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL5 and AANAT1

Sequence 1:NP_611403.1 Gene:AANATL5 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_995934.1 Gene:AANAT1 FlyBaseID:FBgn0019643 Length:275 Species:Drosophila melanogaster

Alignment Length:224 Identity:55/225 (24%)
Similarity:107/225 (48%) Gaps:13/225 (6%)


  Fly     3 LSQNDGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYLAVIRQGLSIV 67
            :.|:...|:.:::.:|...|...:..:|..|||:...|:    |...:|:::..|..:....|..
  Fly    51 VDQDCPYTIELIQPEDGEAVIAMLKTFFFKDEPLNTFLD----LGECKELEKYSLKPLPDNCSYK 111

  Fly    68 ALDDNNGGLLVGIAVAETM---DPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERF-GV 128
            |:  |..|.::|:.:...|   .|.::.:  |.|:..|.....:....:..||.:.|||:.: ..
  Fly   112 AV--NKKGEIIGVFLNGLMRRPSPDDVPE--KAADSCEHPKFKKILSLMDHVEEQFNIFDVYPDE 172

  Fly   129 SSYLSLLVISVHPSMRQRGILVILSKCLFKLGRLRGLRLFIGSGTNHYSSRSAMKAGCECIHSVA 193
            ...|...::||..:.|..||...|::..::..|..|:.::....::|||:|...|.|...:..:.
  Fly   173 ELILDGKILSVDTNYRGLGIAGRLTERAYEYMRENGINVYHVLCSSHYSARVMEKLGFHEVFRMQ 237

  Fly   194 YADYKDEQGRPIYNPPAPHTHIRVLASKL 222
            :|||| .||..::.|.|||..|:|:|.::
  Fly   238 FADYK-PQGEVVFKPAAPHVGIQVMAKEV 265

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL5NP_611403.1 None
AANAT1NP_995934.1 RimI <168..235 CDD:223532 15/67 (22%)
NAT_SF <183..227 CDD:302625 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1342059
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001559
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.