DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL5 and R05H10.7

Sequence 1:NP_611403.1 Gene:AANATL5 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_001022271.1 Gene:R05H10.7 WormBaseID:WBGene00011046 Length:226 Species:Caenorhabditis elegans

Alignment Length:225 Identity:48/226 (21%)
Similarity:83/226 (37%) Gaps:37/226 (16%)


  Fly    12 RVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYL-----------AVIRQGLS 65
            |:.|:.|.|.|..|:.:::...||....|:   .::.|.||..:.|           .|..|...
 Worm     8 RLAKKSDAPDVLNFLLEHYFPLEPCTRALK---LIKSEAEVLYESLVARCLQFPFSTVVTTQSGE 69

  Fly    66 IVALDDNNGGLLVGIAVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERF---- 126
            |||       .||..|.....:.:|.|..  |.:|      |.:....|.::......|.|    
 Worm    70 IVA-------CLVNSAWKRDDNAVEGADY--EVDE------GLTENMTAFIKMLNTCHEDFWNLA 119

  Fly   127 --GVSSYLSLLVISVHPSMRQRGILVILSKCLFKLGRLRGLRL-FIGSGTNHYSSRSAM-KAGCE 187
              .::..|...|.||....::|||...:........:|....: .:.|.|..:.::..: |.|.:
 Worm   120 PQNINVVLHREVSSVSEKYQRRGIATKMLTTNMPKAKLDEYSIDGVLSETCSFGNQVLLEKHGFK 184

  Fly   188 CIHSVAYADYKDEQGRPIYNPPAPHTHIRV 217
            |:.::.|....|.||..|.......|.:::
 Worm   185 CLKTIPYTGIVDSQGNQILKTDDGSTELKL 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL5NP_611403.1 None
R05H10.7NP_001022271.1 Acetyltransf_7 <134..184 CDD:316066 9/50 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 1 0.910 0.722 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.