DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL5 and AANATL3

Sequence 1:NP_611403.1 Gene:AANATL5 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_610018.1 Gene:AANATL3 FlyBaseID:FBgn0032839 Length:222 Species:Drosophila melanogaster

Alignment Length:222 Identity:94/223 (42%)
Similarity:135/223 (61%) Gaps:0/223 (0%)


  Fly     1 MILSQNDGITVRVMKEDDYPRVKTFMTDYFHYDEPMGMGLEEPIHLQHEEEVDRQYLAVIRQGLS 65
            |..|..||||:|.|.::|||.||.|:.|.|...||:.....|.:..|:|:|.|..:|::|.||..
  Fly     1 MASSIKDGITIRTMTKEDYPSVKAFLKDNFFQSEPLCQSTSENVQSQNEKENDEYHLSMIAQGTC 65

  Fly    66 IVALDDNNGGLLVGIAVAETMDPIEMAKQHKEAEEMEPNALGRSRKFIAKVEREANIFERFGVSS 130
            :||:|::|||..||:.:|....|.::.|...|||.||.:...|:...::|:|||||:|||||:|.
  Fly    66 LVAIDESNGGKFVGLVLAGAQYPEDLEKHRIEAESMEQHFWARACIMLSKIEREANLFERFGISK 130

  Fly   131 YLSLLVISVHPSMRQRGILVILSKCLFKLGRLRGLRLFIGSGTNHYSSRSAMKAGCECIHSVAYA 195
            .|...:.||..|||.:|:...|:..|..:||.:|........|:.||:|.....|.:|:||:.||
  Fly   131 LLYSHITSVESSMRGKGLGSRLAATLMDVGRAKGFPAMTAYCTSFYSARQKEALGMKCVHSLPYA 195

  Fly   196 DYKDEQGRPIYNPPAPHTHIRVLASKL 222
            ||||:|||||:.|..|||..|::..||
  Fly   196 DYKDDQGRPIFTPAEPHTMARIMFIKL 222

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL5NP_611403.1 None
AANATL3NP_610018.1 NAT_SF <122..182 CDD:302625 22/60 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1341753
eggNOG 1 0.900 E1_2E94Y
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR20905
RoundUp 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.