powered by:
Protein Alignment AANATL5 and CG31493
DIOPT Version :9
| Sequence 1: | NP_611403.1 |
Gene: | AANATL5 / 37210 |
FlyBaseID: | FBgn0034426 |
Length: | 222 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_731135.2 |
Gene: | CG31493 / 318765 |
FlyBaseID: | FBgn0051493 |
Length: | 246 |
Species: | Drosophila melanogaster |
| Alignment Length: | 67 |
Identity: | 16/67 - (23%) |
| Similarity: | 30/67 - (44%) |
Gaps: | 8/67 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 HLQHEEEVDRQYLAVI----RQGLSIVALDDNNGGLLVGIAVAETMDPIEMAKQHKEAEEME-PN 104
|.|.:...|.:|:|.: |:||..:....: :.....:|:...|:|:..|..|...:| |.
Fly 127 HCQVDSTGDVEYMATLPEFRRRGLGHILCQQS---IQFASLLAQRKLPLEILNQLPEEMRIERPQ 188
Fly 105 AL 106
|:
Fly 189 AI 190
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C45435048 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
1 |
1.100 |
- |
- |
P |
PTHR20905 |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.