DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AANATL5 and CG31493

DIOPT Version :10

Sequence 1:NP_611403.1 Gene:AANATL5 / 37210 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_731135.2 Gene:CG31493 / 318765 FlyBaseID:FBgn0051493 Length:246 Species:Drosophila melanogaster


Alignment Length:67 Identity:16/67 - (23%)
Similarity:30/67 - (44%) Gaps:8/67 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 HLQHEEEVDRQYLAVI----RQGLSIVALDDNNGGLLVGIAVAETMDPIEMAKQHKEAEEME-PN 104
            |.|.:...|.:|:|.:    |:||..:....:   :.....:|:...|:|:..|..|...:| |.
  Fly   127 HCQVDSTGDVEYMATLPEFRRRGLGHILCQQS---IQFASLLAQRKLPLEILNQLPEEMRIERPQ 188

  Fly   105 AL 106
            |:
  Fly   189 AI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AANATL5NP_611403.1 None
CG31493NP_731135.2 PhnO <131..>184 CDD:440222 11/55 (20%)

Return to query results.
Submit another query.