| Sequence 1: | NP_611403.1 | Gene: | AANATL5 / 37210 | FlyBaseID: | FBgn0034426 | Length: | 222 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_503329.2 | Gene: | R13D11.4 / 187863 | WormBaseID: | WBGene00020058 | Length: | 227 | Species: | Caenorhabditis elegans |
| Alignment Length: | 234 | Identity: | 56/234 - (23%) |
|---|---|---|---|
| Similarity: | 83/234 - (35%) | Gaps: | 66/234 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 14 MKEDDYPRVK----------TFMTDYFHYDEPM----GMGLEE---------------PIHLQHE 49
Fly 50 EEVDRQYLAVIRQGLSIVALDDNNGGLLVGIAVAETMDPIEMAKQHKEAEEM-EPNALGR-SRKF 112
Fly 113 IAKV-----EREANIFE-RFGVSSYLSLLVISVHPSMRQRGILVILSKCLFKLGRLRGLRLF--- 168
Fly 169 -IGSGTNHYSSRSAM-KAGCECIHSVAYADYKDEQGRPI 205 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| AANATL5 | NP_611403.1 | None | |||
| R13D11.4 | NP_503329.2 | Acetyltransf_1 | <130..191 | CDD:366181 | 15/63 (24%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_2E94Y | |
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR20905 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 3.000 | |||||