DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL5 and R13D11.4

Sequence 1:NP_611403.1 Gene:AANATL5 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_503329.2 Gene:R13D11.4 WormBaseID:WBGene00020058 Length:227 Species:Caenorhabditis elegans

Alignment Length:234 Identity:56/235 (24%)
Similarity:83/235 (35%) Gaps:66/235 (28%)


  Fly    14 MKEDDYPRVK----------TFMTDYFHYDEPM----GMGLEE---------------PIHLQHE 49
            |.||:|..|:          .|:..:|..:|||    ||..|.               |......
 Worm     1 MSEDNYEFVQLTNENSSELSEFLMSHFLLEEPMNRAIGMSRENFQPFVDKLFERTLNIPFSFALV 65

  Fly    50 EEVDRQYLAVIRQGLSIVALDDNNGGLLVGIAVAETMDPIEMAKQHKEAEEM-EPNALGR-SRKF 112
            |:..|::.|.....|.|...:|          ||           ||:.|.. :....|. .||.
 Worm    66 EKDSRKFAACAMSSLWINEKND----------VA-----------HKDTENHGDEFTFGNPERKD 109

  Fly   113 IAKV-----EREANIFE-RFGVSSYLSLLVISVHPSMRQRGILVILSKCLFKLGRLRGLRLF--- 168
            ||.|     |.....|| ...|...|.|.::||....::||   :.|:.:.|:.....:|.|   
 Worm   110 IAAVGKILTELHGKFFEICLDVEQALHLEILSVAKEHQRRG---LASRLMAKMEDPAKMREFKCS 171

  Fly   169 -IGSGTNHYSSRSAM-KAGCECIHSVAYADYKDEQGRPI 205
             |.|..:..:::..| |.|...:....:|...||.|||:
 Worm   172 KIASEISSLANQCLMKKRGYTALTETLFASECDESGRPL 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
AANATL5NP_611403.1 None
R13D11.4NP_503329.2 Acetyltransf_1 129..192 CDD:278980 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2E94Y
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.000

Return to query results.
Submit another query.