DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: AANATL5 and R05H10.1

Sequence 1:NP_611403.1 Gene:AANATL5 FlyBaseID:FBgn0034426 Length:222 Species:Drosophila melanogaster
Sequence 2:NP_497076.1 Gene:R05H10.1 WormBaseID:WBGene00011042 Length:250 Species:Caenorhabditis elegans

Alignment Length:211 Identity:39/212 (18%)
Similarity:87/212 (41%) Gaps:35/212 (17%)


  Fly    12 RVMKEDDYPRVKTFMTDYFHYDEP----MGMGLEEPIHLQHEEEVDRQYLAVIRQGLSIVALDDN 72
            |..::.|:.|:..|:.::|:::||    ..:.|||.:.:..|.......|.:    .::|..:| 
 Worm     8 RTAEKSDFDRILKFLAEHFYHEEPSIRASKIALEEWLPIFGEMTTSSLKLPI----STVVTTED- 67

  Fly    73 NGGLLVGIAVAETMDPIEMAKQHKEAEEMEPNALGRS-----------RKFIAKVEREANIFERF 126
             |..:|.:.       :......:|.||...:..|:.           ::|:..|::..:.|...
 Worm    68 -GENIVAVL-------LNSMWSREEDEERMKHGNGKGDHDTSGYSEALQRFMTIVQKCHDEFWNL 124

  Fly   127 GVSSYLSLLVI----SVHPSMRQRGILVILSKCLFKLGRLRGLRLFIGSGTNHYSSRSAM-KAGC 186
            ..|. ::|:|.    ||....:::||...:........||..:...: |.|:.:::::.: |.|.
 Worm   125 APSD-VNLVVYREISSVGKPWQRQGIATKMLSRNMSAARLHNVDGIV-SATSSFANQTLLAKNGF 187

  Fly   187 ECIHSVAYADYKDEQG 202
            :|:....|:......|
 Worm   188 QCLKEFPYSGIVSSNG 203



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1342482
eggNOG 1 0.900 E1_2E94Y
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1185856at2759
OrthoFinder 1 1.000 FOG0001559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR20905
Phylome 1 0.910 0.700 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.