DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wbl and Erp29

Sequence 1:NP_001286609.1 Gene:wbl FlyBaseID:FBgn0004003 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_080405.1 Gene:Erp29 MGIID:1914647 Length:262 Species:Mus musculus

Alignment Length:276 Identity:81/277 (29%)
Similarity:137/277 (49%) Gaps:48/277 (17%)


  Fly     1 MMHILVTLLLV-------AIHSIPTTWAVTCTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEK 58
            ::.:|:.|||:       .:|:         .|.:.||.::|.|.:.:..:.:||||..||||||
Mouse    16 LLSVLLGLLLLFAPHGGSGLHT---------KGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEK 71

  Fly    59 HEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPS 123
            .:.|...:::: .::::||:|.||:.|||:..|..|.::||:|.:::|..:||:           
Mouse    72 QDEFKRLAENS-ASSEELLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFR----------- 124

  Fly   124 HVDVTLDNLKAFVSA-----------NTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQA 177
              |..|:|...:..|           ...:|:|..||:..::.:...:......|..:.|.| |.
Mouse   125 --DGDLENPVLYNGAVKVGAIQRWLKGQGVYLGMPGCLPAYDALAGEFIKASSIEARQAILK-QG 186

  Fly   178 KQEQLTDPEQQQN-ARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEV 241
            :...|:..|.::. |..||..|.||.:.|.||...|..|:.:|...|::::|||||.:.||||..
Mouse   187 QDGLLSVKETEKKWASQYLKIMGKILDQGEDFPASEMARIGKLIENKMSDSKKEELQKSLNILTA 251

  Fly   242 FRVHKVTKTAPEKEEL 257
            ||     |...|||||
Mouse   252 FR-----KKEAEKEEL 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wblNP_001286609.1 ERp29_N 22..147 CDD:254509 38/136 (28%)
ERp29 149..242 CDD:285048 29/94 (31%)
Erp29NP_080405.1 Thioredoxin_like 35..157 CDD:294274 39/145 (27%)
ERp29 159..252 CDD:285048 29/94 (31%)
Prevents secretion from ER. {ECO:0000255|PROSITE-ProRule:PRU10138} 259..262 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C294563769
eggNOG 1 0.900 E1_28K2V
Hieranoid 1 1.000
Homologene 1 1.000 H4963
Inparanoid 1 1.050 116 1.000 Inparanoid score I4769
Isobase 1 0.950 0 Normalized mean entropy S7243
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0010916
OrthoInspector 1 1.000 T1082533
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12211
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4822
TreeFam 1 0.960
1312.840

Return to query results.
Submit another query.