DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wbl and Erp29

Sequence 1:NP_001286609.1 Gene:wbl FlyBaseID:FBgn0004003 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_446413.1 Gene:Erp29 RGDID:619781 Length:260 Species:Rattus norvegicus

Alignment Length:266 Identity:82/267 (31%)
Similarity:140/267 (52%) Gaps:28/267 (10%)


  Fly     1 MMHILVTLLLVA-------IHSIPTTWAVTCTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEK 58
            ::.:|:.|||::       :|:         .|.:.||.::|.|.:.:..:.:||||..||||||
  Rat    14 LLSVLLGLLLLSAPHGASGLHT---------KGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEK 69

  Fly    59 HEAFTAFSKSAHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLFKGNADEYVQLPS 123
            .:.|...:::: .::.|||:|.||:.|||:..|..|.::||:|.:::|..:||: :.|....:|.
  Rat    70 QDEFKRLAENS-ASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFR-DGDFENPVPY 132

  Fly   124 HVDVTLDNLKAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAEQLKLIEKLQAKQEQLTDPEQQ 188
            ...|.:..::.::... .:|:|..||:..::.:...:......|..:.|  |:..|:.|:..::.
  Rat   133 SGAVKVGAIQRWLKGQ-GVYLGMPGCLPAYDALAGQFIEASSREARQAI--LKQGQDGLSGVKET 194

  Fly   189 QN--ARAYLIYMRKIHEVGYDFLEEETKRLLRLKAGKVTEAKKEELLRKLNILEVFRVHKVTKTA 251
            ..  |..||..|.||.:.|.||...|..|:.:|...|::|.|||||.|.||||..||     |..
  Rat   195 DKKWASQYLKIMGKILDQGEDFPASELARISKLIENKMSEGKKEELQRSLNILTAFR-----KKG 254

  Fly   252 PEKEEL 257
            .|||||
  Rat   255 AEKEEL 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wblNP_001286609.1 ERp29_N 22..147 CDD:254509 38/125 (30%)
ERp29 149..242 CDD:285048 30/95 (32%)
Erp29NP_446413.1 PDI_a_ERp29_N 36..149 CDD:239305 36/116 (31%)
ERp29 157..250 CDD:285048 30/95 (32%)
Prevents secretion from ER 257..260 3/3 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C294562211
eggNOG 1 0.900 E1_28K2V
Hieranoid 1 1.000
Homologene 1 1.000 H4963
Inparanoid 1 1.050 121 1.000 Inparanoid score I4589
OMA 1 1.010
OrthoDB 1 1.010 D1535651at2759
OrthoFinder 1 1.000 FOG0010916
OrthoInspector 1 1.000 T1086126
orthoMCL 1 0.900 OOG5_135364
Panther 1 1.100 LDO PTHR12211
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.