DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: wbl and erp29

Sequence 1:NP_001286609.1 Gene:wbl FlyBaseID:FBgn0004003 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_002940171.2 Gene:erp29 XenbaseID:XB-GENE-6045950 Length:282 Species:Xenopus tropicalis

Alignment Length:257 Identity:76/258 (29%)
Similarity:136/258 (53%) Gaps:19/258 (7%)


  Fly     4 ILVTLLLVAIHSIPTTWAVTCTGCVDLDELSFEKTVERFPYSVVKFDIAYPYGEKHEAFTAFSKS 68
            :|||.|      :...||:...|.:.||.::|.|.:.:..:.:||||..||||.:.:.|...::|
 Frog    42 LLVTCL------VQRCWAMHTKGSLALDHITFYKVIPKSRFVLVKFDTQYPYGVQQDEFKQLAES 100

  Fly    69 AHKATKDLLIATVGVKDYGELENKALGDRYKVDDKNFPSIFLF-KGNADEYVQLPSHVDVTLDNL 132
            : .::||||:|.||:.|||:..|..|.:::.:|.:.||..:|| .||....|.....|..:...|
 Frog   101 S-SSSKDLLVAHVGISDYGDKLNLELAEKFNLDKEKFPYYYLFVNGNIANPVIYVGPVKTSAIQL 164

  Fly   133 KAFVSANTPLYIGRDGCIKEFNEVLKNYANIPDAE-QLKLIEKLQAKQEQLTDPEQQQNARAYLI 196
            ......   :|:|..|||::::.:...:....:.| |..|:.:.:|...:..:.|:.. |..|:.
 Frog   165 WLKTQG---VYLGMPGCIEQYDALAGEFLLTTEKEKQSNLLIRARALMAEAGESEKHA-AEQYIK 225

  Fly   197 YMRKIHEVGYDFLEEETKRLLRL-KAGKVTEAKKEELLRKLNILEVFRVHKVTKTAPEKEEL 257
            .|.||.:.|.:|...|.:|:.:| :..::::.||::|.::||||..|: :|.|.    :|||
 Frog   226 IMSKIIDQGENFAHNEYERITKLIEKNQMSQPKKDDLQKRLNILSSFQ-NKNTM----REEL 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
wblNP_001286609.1 ERp29_N 22..147 CDD:254509 39/126 (31%)
ERp29 149..242 CDD:285048 24/95 (25%)
erp29XP_002940171.2 Thioredoxin_like 54..176 CDD:294274 39/126 (31%)
ERp29 178..272 CDD:285048 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C294562913
eggNOG 1 0.900 E1_28K2V
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H4963
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1535651at2759
OrthoFinder 1 1.000 FOG0010916
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.720

Return to query results.
Submit another query.