DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18605 and topors

DIOPT Version :8

Sequence 1:NP_001188974.1 Gene:CG18605 / 37189 FlyBaseID:FBgn0034411 Length:415 Species:Drosophila melanogaster
Sequence 2:XP_002940310.1 Gene:topors / 734040 XenbaseID:XB-GENE-994244 Length:1018 Species:Xenopus tropicalis

Alignment Length:123 Identity:36/124 (29%)
Similarity:69/124 (56%) Gaps:1/124 (1%)


  Fly     4 RHMVQWRIYVYANSLYSLPDRETGDFRGWSPEYFRLNPFEVHRVMMWVNRDVSVLIRTRKADIFY 68
            :.::.:|..:|.:.:.....::.|.:|..|.|:||.||..:||::.|:.|:::||..:..:.:..
 Frog   211 QELINFRRALYRSGIRVRNIQDGGRYRDISAEFFRRNPACLHRLVPWLKRELTVLFGSHGSLVNI 275

  Fly    69 LYETIKNLLPRLKLDSEEFRKPMIHFFGANTDLFIHELINFARSPYDTLMAYECSTQY 126
            :...|.:.:.|..::|:.|.:.:..|....||.||||.:||||.||: :.||:....|
 Frog   276 VQHIIMSNVTRYDMESQAFVEDLRPFLLHRTDHFIHEFVNFARCPYN-IEAYDQHANY 332

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18605NP_001188974.1 None
toporsXP_002940310.1 RING 58..101 CDD:238093
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C314178957
eggNOG 1 0.900 E1_KOG4430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.