DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Topors and PEX10

DIOPT Version :9

Sequence 1:NP_001261083.1 Gene:Topors / 37188 FlyBaseID:FBgn0267351 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_565621.1 Gene:PEX10 / 817175 AraportID:AT2G26350 Length:381 Species:Arabidopsis thaliana

Alignment Length:137 Identity:39/137 - (28%)
Similarity:51/137 - (37%) Gaps:47/137 - (34%)


  Fly    25 VIVEPGLEGSN------------------AGGRTLPAAAIKFADLTESGSESGDNEAEEPVSAGP 71
            ::...||..||                  :|||.||.       |.|.|:.. .:|||:      
plant   260 ILAAEGLRRSNLSSITSSIQQASIGSYQTSGGRGLPV-------LNEEGNLI-TSEAEK------ 310

  Fly    72 DNANAIGEPGTSASAAEENGTVERNSPPPNCAICLSRCRRKCFTDSCMHQFCFKCLCEWSKIKPE 136
                  |...||.|.:.|        ....|.:||| .|:......|.|.||:.|:.||...|.|
plant   311 ------GNWSTSDSTSTE--------AVGKCTLCLS-TRQHPTATPCGHVFCWSCIMEWCNEKQE 360

  Fly   137 CPLCKQP 143
            ||||:.|
plant   361 CPLCRTP 367

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ToporsNP_001261083.1 RING 102..144 CDD:238093 19/42 (45%)
PEX10NP_565621.1 Pex2_Pex12 41..268 CDD:282595 2/7 (29%)
RING 326..367 CDD:238093 18/41 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23350
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.