DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Topors and Toporsl

DIOPT Version :8

Sequence 1:NP_001261083.1 Gene:Topors / 37188 FlyBaseID:FBgn0267351 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_001343222.1 Gene:Toporsl / 68274 MGIID:1915524 Length:683 Species:Mus musculus

Alignment Length:792 Identity:148/793 (19%)
Similarity:251/793 (32%) Gaps:257/793 (32%)


  Fly   227 RFEPYRSELMNYYQHDQDASTSGSLSQLWRRYVYDRKLYALPVSDSVTGHFREWSARFYRNNPAQ 291
            |..|:...|.::..|         :...:||.:|...::...|..|  |..|.:||.:::.||:.
Mouse   116 RLPPHSVSLSHFRDH---------VVVKFRRALYYSGIWVKYVQGS--GLKRFFSAHYFKRNPSS 169

  Fly   292 IHRLMPWIHRDIMCLLRNAAHSVNTVMTLMSDLLPMTSLLGPTFRRRLSPYLGERTSHFIHELFN 356
            :|||:||:.|::..:..:..::|..::|.:...:...:|....|...|.|||.:.|.||:||..:
Mouse   170 LHRLIPWLKRELTAICGDYGYTVKNILTAILHHMTKFNLNSEAFTHLLEPYLFQYTQHFLHEFIS 234

  Fly   357 FARSPYDINGYDHVVQYSARVAEEVEVDLLDMVETQSSNGDDLNLEVGDSDADAINAGFSPDWSP 421
            |..|.|::..||....|...|::                        .......::|   |.:|.
Mouse   235 FVDSSYNMETYDRNAIYQCPVSK------------------------SSKKKSTVSA---PAFSF 272

  Fly   422 PRVRPSTSVIVTNPGATHSFSVTMASDGSELPGISIRRTTNVGSQTVAINLSMRRPAAVASEEPE 486
            |:   ..|.:.:..|...|                 ::|.|...|               |.:..
Mouse   273 PQ---ELSFMKSQRGIKQS-----------------KKTWNKTGQ---------------SSDSG 302

  Fly   487 VIEIDDGDAAANAEVAAINDGSNTSRRHAGATLPVTAHIELESSSSSGDEDECVFVLELKPPHMR 551
            :.:...|.::.|.:::                   |.|                    .||    
Mouse   303 LKQFPKGHSSKNPQIS-------------------TTH--------------------QKP---- 324

  Fly   552 TPEQVSLDSNSDSDVVFVNEQHEAAPDAIAENRSTQSPLDLASRDQGLFMGPSTSGAAANRGKNW 616
                             .|::|....|            :..|.|   |.|.    .......||
Mouse   325 -----------------ANKRHVWTKD------------EWGSDD---FRGV----VCTTNSLNW 353

  Fly   617 KLVMAQTRRLDQLRTLRSIRSKKSRRSSMPARSDSGSSPSSCSSSSFHFSSSSDEDSSDSSTTNS 681
            ..:.|  ||||:.......|.|||..:.:|        |........|.:|.:...:...|  |.
Mouse   354 AYLRA--RRLDKEYYRNDNREKKSESTKLP--------PGHVQDLKSHETSPNIFRALVDS--NQ 406

  Fly   682 EPPKKKSRKRVANNKRSKKESIGKRTSRKRKAKDQNMEMLEQQQISQKKPQRQPESS--SDSPSS 744
            .||||.:.:........::....|:.:.::|.::.:::.|          ||.|:..  ..|.|.
Mouse   407 APPKKYNIRETNVLDPGQQVHYQKKETERKKLEESSLKAL----------QRLPKERILIKSKSR 461

  Fly   745 SDDESGGDSSESSGQPNTNNNKSSSDSDDDSAVNMQLSALRATLKAEATLEDRKPVKLELQLPDD 809
            ..:.|....||:|..|..|:...:|.|                         :|.|:.. |....
Mouse   462 ESNHSCLCVSENSTSPTRNDKMLTSIS-------------------------KKMVRCS-QSSQC 500

  Fly   810 DQAGPLHSRMTP---SPREDNEPGCSAPKRRRSCSHSNQSSQSASLASSSTATSSSAPLSSFAWG 871
            .:.|..|||.|.   |||        .|:.:..|....:.|.|...::.|...|..:...:.:.|
Mouse   501 VEVGSHHSRRTQRQYSPR--------TPRSKSWCVRIRKQSMSRGQSNLSLRESHRSKHCALSKG 557

  Fly   872 AAGFSGDPLMRGHPAMEEHDIANSLIELS-------TLTQPVN-----IGLFNEHYNSAENSMGM 924
            :|          |.....:.:|:    ||       .||...|     :|..........:|:..
Mouse   558 SA----------HGCESTYRVAS----LSPVHHDQVCLTAGKNCKCASMGEGESQTGGHCDSLSC 608

  Fly   925 LSNTLCDSPQTLAADDANLENYFDTDADPEASRERDAYSLEAAIDVVGESELQIAEDTATATEEQ 989
            |....|.||..|.....:|..        ..:|.|.....:.....||         |.|..|.:
Mouse   609 LKTEKCHSPSKLGMKGKHLVG--------RVTRIRTHRRKKPKYQCVG---------TQTTAEFR 656

  Fly   990 DE-EDEEDEDQE 1000
            |: .|.||:.|:
Mouse   657 DDLGDLEDKSQK 668

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ToporsNP_001261083.1 RING 102..144 CDD:238093
ToporslNP_001343222.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C314182137
eggNOG 1 0.900 E1_KOG4430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T616396
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.790

Return to query results.
Submit another query.