DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Topors and l(3)psg2

DIOPT Version :8

Sequence 1:NP_001261083.1 Gene:Topors / 37188 FlyBaseID:FBgn0267351 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_647974.1 Gene:l(3)psg2 / 38630 FlyBaseID:FBgn0035617 Length:1929 Species:Drosophila melanogaster

Alignment Length:928 Identity:190/929 (20%)
Similarity:297/929 (32%) Gaps:330/929 (36%)


  Fly    51 LTESGSESGDNEAEE--PVSAGPDNANAIGEPGTSASAAEENGTVERNSPPPNCAICLSRCRRKC 113
            :|:...|||.:...|  |...|.|.:.....|..|.|  |...|.|..|            |||.
  Fly   576 VTKCPKESGKDTLMEHPPQENGLDGSKRSSMPHESFS--ESAKTREHAS------------RRKN 626

  Fly   114 FTDSCMHQFCFKCLCEWSK---IKPECPLCKQPFRTIIHNVRTLDDYDRY-------------PV 162
            .|           |..|..   ..|..|...|..:|.|.::....|:|.:             |.
  Fly   627 QT-----------LSPWGSREGTPPMTPPQVQIPQTPIVDIANPKDFDIFADSPPRVNTAVSAPA 680

  Fly   163 -----QTTSPVPTENPSLRYHIVRRPRYTPLVQNQAVIVNDIEAAIAAGAAGEDV----LSAAEV 218
                 .||.|:.:..|.:  .|.:..:..||::     .::|.:.|.|.....|:    |.|.:.
  Fly   681 ATIERSTTPPLKSSIPIV--PIAKADKLAPLLK-----ASEIHSRIGALLEESDLHLDNLLATKE 738

  Fly   219 AAGRRSYSRFEPYRSELMNYYQHDQDASTSGSLSQLWRRYVYDRKLYALPVS---DSVTGHFREW 280
            ...||:            |.|:..::|..             :.|...||.|   .|.||..   
  Fly   739 QLFRRT------------NEYKERKEAPK-------------EIKAEYLPNSRHNRSATGRA--- 775

  Fly   281 SARFYRNNPAQIHRLMPWIHRDIMCLLRNAAHSVNTVMTLMSDLLPMTSLLGPTFRRRLSPYLGE 345
            ....:::.|..|:   |:....::...::::.                    |:.:.|       
  Fly   776 EVEHHKSQPRHIN---PFKRESVLSGRKSSSR--------------------PSSKER------- 810

  Fly   346 RTSHFIHELFNFARSPYDINGYDHVVQYSARVAEEVEVDLLDMVETQSSNGDDLNLEVGDSDADA 410
                      .|.|...::..:|..::                :|....||..|           
  Fly   811 ----------RFQRHDSEVENWDRDLE----------------LERNQLNGSQL----------- 838

  Fly   411 INAGFSP---------------DWSPPRVRPSTSVIVTNPGATHSFSVTMASDGSELPGISIRRT 460
              .||.|               |.:||            |..|:....|:..:.:..|...:...
  Fly   839 --TGFQPRKSDEYTKFSIKKEKDLTPP------------PLQTNFTRTTIKIERNATPPRHMEHD 889

  Fly   461 TNVGSQTVAINLSMRRPAAVASEEPEVIEIDDGDAAANAEVAAINDGSNTSRRHAGATLPVTAHI 525
            ..|.:..||.|..   |.|...|.|     |..|...|.|    ||.|.       |::|..|  
  Fly   890 VLVRNGAVATNAP---PPAKEQESP-----DTDDYIDNWE----NDDSL-------ASMPKNA-- 933

  Fly   526 ELESSSSSGDEDECVFVLELKPPHMRTPEQVSLDSNSDSDVVFVNEQHEAAPDAIAENRSTQSPL 590
                                 ||...||                      ||:|.|...:|..| 
  Fly   934 ---------------------PPVTPTP----------------------APNANASLNATPLP- 954

  Fly   591 DLASRDQG---------LFMGPSTSGAAANRGKNWKLVMAQTRRLDQLRTLRSIR---------- 636
            .:||:..|         |:...||   ...|.||..|.......|.. :.:.||:          
  Fly   955 PVASQFNGDDDDDDSNALWNAKST---PPPRRKNENLPEGNIHELYD-KFMNSIKMSNEHLEPET 1015

  Fly   637 ---SKKSRRSSMPA-RSDSGSSPSSCSSSSFHF--SSSSDEDSSDSSTTNSEPPKKKSRKRVANN 695
               ||.|..|:.|| .|.||:..||.||||...  .||||:|:::|| :|.|............:
  Fly  1016 LDTSKNSSLSNSPAEESSSGTETSSTSSSSSETEDDSSSDDDANESS-SNDESATTSGNCNTNQD 1079

  Fly   696 KRSKKESIGKRTS-----RKRKAKDQNME--------------------------MLEQQQISQK 729
            :.:.||.:.|:.:     ||.|:.:.|:.                          ::::..|..|
  Fly  1080 EAAGKEQLQKKNNVSKDLRKLKSLEDNLARIQMMRENYDAGDEISEELLKMESLFLMQRNAIMDK 1144

  Fly   730 KPQRQPESSSDSPSSSDDESGGDSSESSGQPNTNNNKSSSDSDDDSAVNMQLSALRATLKA---- 790
            ..:::.:|:|.......||.|...::...: .|:...:|..|.:..|:.:.:|.|:.|.|:    
  Fly  1145 YRKQELKSNSSEDQQPVDEQGTVQAQEVVK-ETSFPVNSIFSANREAIKLTISPLKLTRKSVIFD 1208

  Fly   791 --EATLED---RKPVKLELQLPDDDQA--GP--LHSRMTPSPREDNEPGCSAPKRRRSCSHSNQS 846
              ||.|.:   .:|.|..||.|..:.|  .|  :.||..|..|   .|..|:..||||.|.|...
  Fly  1209 KDEADLPETSKAEPPKQTLQKPQKEIAIVKPTIVESRSKPKLR---SPPPSSGSRRRSRSRSISR 1270

  Fly   847 SQSASLASSSTATSSSAP 864
            |: |....|.|.:.:.:|
  Fly  1271 SR-ARRRGSRTKSRTPSP 1287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ToporsNP_001261083.1 RING 102..144 CDD:238093 9/45 (20%)
l(3)psg2NP_647974.1 PRP38_assoc 374..450 CDD:289628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C313076498
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.