DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Topors and toporsa

DIOPT Version :8

Sequence 1:NP_001261083.1 Gene:Topors / 37188 FlyBaseID:FBgn0267351 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_001292484.1 Gene:toporsa / 324197 ZFINID:ZDB-GENE-030131-6401 Length:999 Species:Danio rerio

Alignment Length:1064 Identity:244/1065 (23%)
Similarity:408/1065 (38%) Gaps:274/1065 (26%)


  Fly    97 SPPPNCAICLSRCRRKCFTDSCMHQFCFKCLCEWSKIKPECPLCKQPFRTIIHNVRTLDDYDRYP 161
            ||...|.|||...:...:.|.|:|:|||.|:.||||.|.|||||||||.:..|.:::.|||.|:.
Zfish    23 SPESKCPICLDHFKNISYLDVCLHKFCFCCIHEWSKNKAECPLCKQPFNSFYHTIKSEDDYKRFD 87

  Fly   162 VQTTSPVPTENPSLRYHIVRRPRYTPLVQNQAVIVNDIEAAIAAGAAGEDVLSAAEVAAGRRSYS 226
            ::     ||||.|......:|.||      :..:..|                       ||...
Zfish    88 LR-----PTENGSFGNMAGQRFRY------RTTLTGD-----------------------RRPVQ 118

  Fly   227 R-----------FEPYRSELMNYYQHDQD--------------ASTSGSLSQL-------WRRYV 259
            |           ||..|..|..  :|::|              .|...||..|       :||.:
Zfish   119 RRTSPPPDHGIIFEGLRGSLPQ--RHNRDLHSMIRRLTVRQRRESEGRSLRSLQDQEVVKFRRAL 181

  Fly   260 YDRKLYALPVSDSVTGHFREWSARFYRNNPAQIHRLMPWIHRDIMCLLRNAAHSVNTVMTLMSDL 324
            |.|.:....|.|.  |..||.||.|::.|||.:|||:||:.|::..|.......||.|..::..|
Zfish   182 YRRGVQVQSVQDG--GRTRETSAEFFKRNPACLHRLVPWLRRELTVLYGAHGSLVNIVQHIIMTL 244

  Fly   325 LPMTSLLGPTFRRRLSPYLGERTSHFIHELFNFARSPYDINGYDHVVQYSARVAEEVEVDLLDMV 389
            :...:|.....:..|.|:|...|.||:||..:|||||:::..||....|.           |...
Zfish   245 ITRHNLDDQAVQHELRPFLLSHTEHFLHEFLSFARSPFNMEAYDQRAVYD-----------LPRP 298

  Fly   390 ETQSSNGDDLNLEVGDSDADAINAGFSPDWSPPRVRPS-TSVIVTNPGATHSFSVTMASDGSELP 453
            ..:||:.::..:.:.:.:::::.:| :.|::.|||..| |:.....||.::|      |:.|::.
Zfish   299 SGESSSSENSVIAISEDESESLVSG-AQDFATPRVTSSQTAWDDETPGPSYS------SERSQVL 356

  Fly   454 GISIRRT---TNVGSQTVAINLSMRRPAAVASEEPEVIEIDDGDAAANAEVAAINDGSNTSRRHA 515
            .:.:|.:   ::||...:.|       |||..:          |..||                 
Zfish   357 PVHVRDSDSDSSVGEAVMPI-------AAVRHQ----------DHPAN----------------- 387

  Fly   516 GATLPVTAHIELESSSSSGDEDECVFVLELKPPHMRTPEQVSLDSNSDSDVVFVNEQHEAAPDAI 580
                |.|...| |..|||.||| ||.:..:||...||||.|.|.|:|::.    ..:..|:|   
Zfish   388 ----PSTIQPE-EDHSSSNDED-CVIIGYVKPVAERTPELVQLSSDSENS----ETEQNASP--- 439

  Fly   581 AENRSTQSPLDLASRDQGLFMGPSTSGAAANRGKNWKLVMAQTRRLDQLRTLR----SIRSKKS- 640
               |::|:|..:.      |:..|.:...|::                 |.||    |.||.:. 
Zfish   440 ---RNSQAPQHIR------FISDSDASPTASQ-----------------RPLRGPASSSRSFEDT 478

  Fly   641 ----RRSSMPARSDSGSSPSSCSSSSFHFSSSSDEDSSDSSTTNSEPPKKK-------------- 687
                |::|....:.|||...|..|...|.||...:......:.|.:..:|:              
Zfish   479 SIQLRKNSKYDNTFSGSREGSSQSKRIHSSSHRKKQPLCKESKNKQRGEKETSRHSSSYWHSYSY 543

  Fly   688 -----SRKRVANNK-------RSKKESIGKRTSRKRKAKD--QNMEMLEQQQISQKKPQRQPESS 738
                 |||......       ||..:..|.|:..||:.:|  .........:|||...:.:..|.
Zfish   544 YSHDNSRKAYTETSSSYTSYYRSVNDQFGSRSHGKRRCRDLLDRSRSRSNSRISQSNRRNRSRSR 608

  Fly   739 SDSP-SSSDDESGGDSSESSGQPNTN-NNKSSSDSDDDSAV----NMQLSALRATLKAEATLEDR 797
            |:|. |.|:..:...|..:||:..:| .|:|.|.|...::.    |.:.|...:. |:::...:|
Zfish   609 SNSRISRSNQRNRSHSRSNSGKSQSNRRNRSCSRSYSRTSPFNERNRRHSRSNSR-KSQSNRHNR 672

  Fly   798 KPVKLELQLPDDDQAGPLHSRMTPSPREDN--EPGCS-------------------------APK 835
            ...:...:....::....|||......:.|  ...||                         :.:
Zfish   673 SCSRSYSRTSPFNERNRRHSRSNSRKSQSNRHNRSCSRSYSRTSPFNQRNRRHSRSNSRISQSSR 737

  Fly   836 RRRSCSHSN-----------QSSQSASLASSSTATSSSAPLSSFAWGAAGFSGDPLMRGHPAMEE 889
            :.||.|.||           ..|:|:|..|.|:..:.|...|:|...::.:      :......:
Zfish   738 QNRSLSRSNSRKGYSNRRNRNHSRSSSRVSQSSQRNRSHSRSNFRIKSSSY------KSQDEKYQ 796

  Fly   890 HDIANSLI------ELSTLTQPVNIGLFNEHYNSAENSMGMLSNTLCDSPQTLAADDANLENYFD 948
            ..::.||.      ..|..:..:|.....:...|..:|. |.|::   |.||...|....:..:.
Zfish   797 RSLSRSLYSNNDVRSRSRSSSRINTSSRQDRRRSRSSSR-MNSSS---SRQTSCHDKYGKKRMYK 857

  Fly   949 TDADPEASRERDAYSLEAAIDVVGESELQIAEDTATATEEQDEEDEEDEDQEEDDQEEEKAAEEE 1013
            |....:.||:..:.|:..:.:|.|:.:           :::..:..:......||:.|..:....
Zfish   858 TKHHEKPSRQSSSKSVGDSDEVGGKKK-----------KKKHTKRRKTRSPSIDDRSEGHSQRHH 911

  Fly  1014 EEEEEDDDDSDNHDENDENQGLLP 1037
            :.:::....|..|:..:..:.|.|
Zfish   912 KRKKKHKKKSKRHNSKERTRKLSP 935

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ToporsNP_001261083.1 RING 102..144 CDD:238093 24/42 (57%)
toporsaNP_001292484.1 RING-HC_Topors 28..67 CDD:319488 21/39 (54%)
RING-HC finger (C3HC4-type) 28..66 CDD:319488 20/38 (53%)
RRM 635..>749 CDD:330708 19/115 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C314171465
eggNOG 1 0.900 E1_KOG4430
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I3751
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005422
OrthoInspector 1 1.000 T597235
orthoMCL 1 0.900 OOG5_133270
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9253
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.