DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Topors and C32D5.10

DIOPT Version :8

Sequence 1:NP_001261083.1 Gene:Topors / 37188 FlyBaseID:FBgn0267351 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_495278.2 Gene:C32D5.10 / 174051 WormBaseID:WBGene00016317 Length:610 Species:Caenorhabditis elegans

Alignment Length:610 Identity:117/611 (19%)
Similarity:206/611 (34%) Gaps:178/611 (29%)


  Fly    68 SAGPDNANAIGEPGTSASAAEENGTVERNSPPPNCAICLSRCRRKCFTDSCMHQFCFKCLCEW-- 130
            |..|...|.|.:.|.|..........|.:.|...|::|.:..........|.|:||:.|:..|  
 Worm     7 SESPLKKNTIQDFGESNMTESPQSKEEIDEPEEECSVCKNEIIDTTSLSDCCHEFCYDCIVGWLT 71

  Fly   131 SKIKPECPLCKQPFRTI----------IHNVRTLDDYDRYPVQTTSPVPTENPSLRYHIVRRPRY 185
            ....|.||:||.|...|          :..:::    :..|..|.|    |:......||.|.  
 Worm    72 KGSGPFCPMCKTPVSFIQRKGTDEKITVQQIKS----EGEPAATAS----EDLVTEKRIVSRK-- 126

  Fly   186 TPLVQNQAVIVNDIEAAIAAGAAGEDVLSAAEVAAGRRSYSRFEPYRS------ELMNYYQHDQD 244
               :::...::|.|:..|.|.::..|         .::...|.|...|      ..:|..|..:|
 Worm   127 ---IRSCRRLMNQIDEIIGATSSRSD---------SQKRKPRLEELNSMKQLCVSQLNSLQMLRD 179

  Fly   245 ASTSGSLSQL------WRRYVYDRKLYALPVSDSVTG----HFREWSARFYRNNPAQIH------ 293
            ....|:...|      :||.:|:|::.:..:.|:...    .||: :...||   |.:|      
 Worm   180 DIDHGAAKALIVSKAAFRRLIYERQVISEGLPDATNSLSKTEFRD-NIDHYR---AVLHSFLSVE 240

  Fly   294 ------RLMPWIHRD---IMCLLRNAAHS-----VNTVMTLMSDLLPM--------TSLLGPTFR 336
                  :..|.:..:   ....|.:.|..     :|.:.:::.|....        .:|.|....
 Worm   241 LKSLPAKTQPRVDNENSWYFYTLHDVAEGKDEEIINRIFSMIEDRGTRDLNAREVDAALNGLVSC 305

  Fly   337 RRLSPYLGERTSHFIHELFNFARSPYDINGYDHVVQYSARVAEEVEVDLLDMVETQSSNGDDLNL 401
            |.:..::.|     :..|.|..:|..:..|   .:.|..|.....|....|:|...    |.:.|
 Worm   306 RVVIAFIAE-----LKSLINSRKSFLEWCG---AITYRIRTDRGGESAGNDVVTVD----DSIEL 358

  Fly   402 EVGDSDADAINAGFSPDWSP-PRVRPST----------SVIVTNPGATHSFSVTMASDGSELPGI 455
            |..::.::..:..| |.::| .||..||          :.:...|.||:.|........|:||..
 Worm   359 EPEENRSNHRSRRF-PVFTPFDRVFGSTMGHMYRGQPQAPLRLGPNATNPFRPAPLPVPSQLPIA 422

  Fly   456 SI----RRTTNVGSQTVAINLSMRRPAAVASEEPEVIEIDDGDAAANAEVAAINDG--------- 507
            .|    ..|::.|:           .:|.:.....|:||||.|.         |||         
 Worm   423 GIPWAELTTSSAGA-----------GSARSRGSDSVVEIDDDDD---------NDGVDVDDDDRE 467

  Fly   508 -SNTSRRHAGATLPVTAHIELESSSSSGDEDECVFVLELKPPHMRTPEQVSLDSNSDSDVVFVNE 571
             |:..|.:               |:|..|.||.:.|:|                  ..|.:.:::
 Worm   468 DSDEPRTY---------------SNSEEDSDEEIQVVE------------------RDDTIILDD 499

  Fly   572 QHEAAPDAIA-----ENRSTQSPLD 591
            .:.:.|..:|     ..|..:.||:
 Worm   500 SNRSLPKPVANGSADRKRKYEFPLE 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ToporsNP_001261083.1 RING 102..144 CDD:238093 14/44 (32%)
C32D5.10NP_495278.2 RING 41..85 CDD:238093 14/44 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T375160
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.