DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Topors and TOPORS

DIOPT Version :8

Sequence 1:NP_001261083.1 Gene:Topors / 37188 FlyBaseID:FBgn0267351 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_005793.2 Gene:TOPORS / 10210 HGNCID:21653 Length:1045 Species:Homo sapiens

Alignment Length:1125 Identity:248/1126 (22%)
Similarity:394/1126 (35%) Gaps:330/1126 (29%)


  Fly    15 YLGVDELGASVIVEPGLEGSNAGGRTLPAAAIKFADLTESGSESGDNEAEE--PVSAGPDNANAI 77
            :||..||.||....|....|.     :.|:|.|...:.....::|.::.::  |..|.||:    
Human    46 FLGCRELAASAPARPAPASSE-----IMASAAKEFKMDNFSPKAGTSKLQQTVPADASPDS---- 101

  Fly    78 GEPGTSASAAEENGTVERNSPPPNCAICLSRCRRKCFTDSCMHQFCFKCLCEWSKIKPECPLCKQ 142
                                   .|.|||.|.....:.|.|:|:|||:|:.||||.|.|||||||
Human   102 -----------------------KCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQ 143

  Fly   143 PFRTIIHNVRTLDDYDRYPVQTTSPVPTENPS-------LRYHI----------------VRRPR 184
            ||.:|.|:||..||:..|.::     |:.|.|       .||..                |.|..
Human   144 PFDSIFHSVRAEDDFKEYVLR-----PSYNGSFVTPDRRFRYRTTLTRERNASVYSPSGPVNRRT 203

  Fly   185 YTP-----LVQNQAVIVNDIEAAIAAGAAGEDVLSAAEVAAGRRSYSRFEPYRSELMNYYQHDQD 244
            .||     |.:...:.....:..|....  ..:.......|..||..:.:  ..:::|:      
Human   204 TTPPDSGVLFEGLGISTRPRDVEIPQFM--RQIAVRRPTTADERSLRKIQ--EQDIINF------ 258

  Fly   245 ASTSGSLSQLWRRYVYDRKLYALPVSDSVTGHFREWSARFYRNNPAQIHRLMPWIHRDIMCLLRN 309
                       ||.:|........:.|.  |.:|:.||.|:|.|||.:|||:||:.|::..|...
Human   259 -----------RRTLYRAGARVRNIEDG--GRYRDISAEFFRRNPACLHRLVPWLKRELTVLFGA 310

  Fly   310 AAHSVNTVMTLMSDLLPMTSLLGPTFRRRLSPYLGERTSHFIHELFNFARSPYDINGYDHVVQYS 374
            ....||.|..::...:....|....|...|.|:|..||.|||||..:|||||:::..:|....| 
Human   311 HGSLVNIVQHIIMSNVTRYDLESQAFVSDLRPFLLNRTEHFIHEFISFARSPFNMAAFDQHANY- 374

  Fly   375 ARVAEEVEVDLLDMVETQSSNGDDLNLEVGDSDADAINAGFSPDWSPPRVRPSTSVIVTNPGATH 439
                                          |..|.:...|...|         :|||..:|....
Human   375 ------------------------------DCPAPSYEEGSHSD---------SSVITISPDEAE 400

  Fly   440 S-------FSVTMASDGSELPGISIRRTTNVGSQTVAINLSMRRPAAVASEEPEVIEIDDGDAAA 497
            :       .:|:.|....|.||.|..     .|:.|.:.:|.....:.:|:|    |:..|.|.:
Human   401 TQELDINVATVSQAPWDDETPGPSYS-----SSEQVHVTMSSLLNTSDSSDE----ELVTGGATS 456

  Fly   498 NAEVAAINDGSNTSRRHAGATLPVTAHIELESSSSSGDEDECVFVLELKPPHMRTPEQVSLDSNS 562
            ..:....||..|.                 :|..||   |.||.|..:||...||||.|.|.|:|
Human   457 QIQGVQTNDDLNN-----------------DSDDSS---DNCVIVGFVKPLAERTPELVELSSDS 501

  Fly   563 DS-------DVVFVNEQHEAAPDAIAENRSTQSPLDLASRDQGLFMGPSTSGAAANRGKNWKLVM 620
            :.       :.|...||.::.....::.....||..:..:|:.:..|...|              
Human   502 EDLGSYEKMETVKTQEQEQSYSSGDSDVSRCSSPHSVLGKDEQINKGHCDS-------------- 552

  Fly   621 AQTRRLDQLRTLRSIRSKKSRRSSMPARSDSGSSPSSCSSS-----------SFHFSSSSDEDSS 674
             .||          |:|||..:     ||.|.|||.:.:||           ..|........|.
Human   553 -STR----------IKSKKEEK-----RSTSLSSPRNLNSSVRGDRVYSPYNHRHRKRGRSRSSD 601

  Fly   675 DSSTTNSEPPKKKSRKRVANNKRSKKESIGKRTSRKRKAKDQNMEMLEQQQISQKKP--QRQPES 737
            ..|.:.|...:|..||.....:...|.|..:.:||.|..:|:..........|::..  ....||
Human   602 SRSQSRSGHDQKNHRKHHGKKRMKSKRSRSRESSRPRGRRDKKRSRTRDSSWSRRSQTLSLSSES 666

  Fly   738 SSDSPSSSDDESGGDSSESSGQPN---TNNNKS---------SSDSDDDSAVNMQLSALRATLKA 790
            :|.|.|.|.|. |...|.|..:..   .||..|         |.:.|.|   ..:.|..|.||..
Human   667 TSRSRSRSSDH-GKRRSRSRNRDRYYLRNNYGSRYKWEYTYYSRNKDRD---GYESSYRRRTLSR 727

  Fly   791 EATLEDRKPVKLELQLPDDDQAGPLHSRMTPSPREDNEPGCSAPKRRRSCSHSN------QSSQS 849
            ..                       :||.:.||....:........|:..:||.      :..:|
Human   728 AH-----------------------YSRQSSSPEFRVQSFSERTNARKKNNHSERKYYYYERHRS 769

  Fly   850 ASLASSSTATSSSAPLSSFAWGAAGFSGDPLMRGHPAMEE----------HDIANSLIELSTLTQ 904
            .||:|:.:.|:|:..             |.:....|..:.          :::|....|.::..:
Human   770 RSLSSNRSRTASTGT-------------DRVRNEKPGGKRKYKTRHLEGTNEVAQPSREFASKAK 821

  Fly   905 PVNIGLFNEHYNSAENSMGMLSNTLCDSPQTLAADDANLENYFDTDADPEAS--------RERDA 961
                   :.||..:.:.:                 |.|.:|..||.:|..:|        |:|..
Human   822 -------DSHYQKSSSKL-----------------DGNYKNESDTFSDSRSSDRETKHKRRKRKT 862

  Fly   962 YSLEAAIDVVGESELQIAEDTATATEEQDEEDEEDEDQEEDDQEEEK-------AAEEEEEEEED 1019
            .||  ::::|.|.:   |.||....:::.::.::...:...|.....       :..:::.|.::
Human   863 RSL--SVEIVYEGK---ATDTTKHHKKKKKKHKKKHKKHHGDNASRSPVVITIDSDSDKDSEVKE 922

  Fly  1020 DDDSDNHDEND--ENQGLLP 1037
            |.:.||....|  :|:.|.|
Human   923 DTECDNSGPQDPLQNEFLAP 942

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ToporsNP_001261083.1 RING 102..144 CDD:238093 25/42 (60%)
TOPORSNP_005793.2 E3 ubiquitin-protein ligase activity 1..195 54/186 (29%)
Required for DNA-binding 51..374 103/383 (27%)
RING 102..145 CDD:238093 25/43 (58%)
Interaction with SUMO1. {ECO:0000269|PubMed:14516784} 437..654 60/271 (22%)
Required for sumoylation and localization to discrete nuclear foci 437..574 45/191 (24%)
Interaction with TOP1. {ECO:0000269|PubMed:10352183} 456..882 111/545 (20%)
Interaction with p53/TP53. {ECO:0000269|PubMed:10415337} 456..731 76/352 (22%)
Interaction with UBE2I. {ECO:0000269|PubMed:14516784} 854..917 10/68 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C314179848
eggNOG 1 0.900 E1_KOG4430
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 169 1.000 Inparanoid score I4084
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005422
OrthoInspector 1 1.000 T1073663
orthoMCL 1 0.900 OOG5_133270
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.958 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R9253
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.680

Return to query results.
Submit another query.