DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: prod and CG15107

Sequence 1:NP_725841.1 Gene:prod FlyBaseID:FBgn0014269 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001261082.1 Gene:CG15107 FlyBaseID:FBgn0041702 Length:243 Species:Drosophila melanogaster

Alignment Length:339 Identity:121/340 (36%)
Similarity:163/340 (48%) Gaps:98/340 (29%)


  Fly     5 MDRRKKRTSSEQYQMYIDMMESDPIFATGRVPRDYDLNYLTKKWKELSDRLNKCSSGPTLTPEEW 69
            |:||.||||..||::|:|.||.:|..:..::.|..|    .||||||||.|||||:||||:||||
  Fly     1 MNRRNKRTSYYQYEVYLDFMEENPPMSANKLSRTQD----GKKWKELSDLLNKCSTGPTLSPEEW 61

  Fly    70 RKRLNDWKNTTRCKYRRSLLSTEKDISMTSVETRALDLFGKVPTTGGETMLNLKSEKDEHDDEME 134
            |||||||||:||.|||||:.|.:|..:||.:|.|||.:|...|        |.:          |
  Fly    62 RKRLNDWKNSTRSKYRRSINSDDKSNAMTPLENRALQIFSLEP--------NFR----------E 108

  Fly   135 ELGQRTSVAFQKELQAAVEEAINDEVDEEEMVEEHVDHEDMMEENLAETGITASTTAVNTGGGTY 199
            .:..|        |...:||  .:|:||||            .|||.|                 
  Fly   109 GISMR--------LHELMEE--QEELDEEE------------NENLEE----------------- 134

  Fly   200 RTIVVDNTSFEHVEEDPQTVQPHAVEYVTSRRPAAPVINPGTASSGNKLINGELPVKRMRTQPRE 264
               :||....|.|:......:||        ..|.|.|           |||....|::|.....
  Fly   135 ---LVDEEEEEEVQYQQFIAEPH--------EQANPTI-----------INGHSAAKKLRLDGSS 177

  Fly   265 QIIYEVKNAPRCISNMQAVPPLHSTKLEREPSSLTSALSSSDAQQIAHQLKRLADIKFETLQFEI 329
            :||||...:...:::.|:.        .:|||:..       .::|..||||::||...:|.|:|
  Fly   178 EIIYEALISVADVTSDQSA--------AKEPSAFY-------GEKIQEQLKRISDIHEASLHFKI 227

  Fly   330 ARFKFNNPGFQYDP 343
            ||||:|||||:|.|
  Fly   228 ARFKYNNPGFEYVP 241

Known Domains:


GeneSequenceDomainRegion External IDIdentity
prodNP_725841.1 Myb_DNA-bind_5 8..83 CDD:290584 46/75 (61%)
CG15107NP_001261082.1 GT1 4..75 CDD:304916 46/75 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140906843
eggNOG 1 0.900 E1_2F673
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.