DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DptB and CG33493

DIOPT Version :10

Sequence 1:NP_523787.2 Gene:DptB / 37184 FlyBaseID:FBgn0034407 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_996038.1 Gene:CG33493 / 2768994 FlyBaseID:FBgn0053493 Length:102 Species:Drosophila melanogaster


Alignment Length:68 Identity:19/68 - (27%)
Similarity:27/68 - (39%) Gaps:6/68 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VPLHRVRRQFQLN-GGGGGSPKQGFDLSLNGRAPVWQSPNGRHSFDATGSYAQHLGGPY---GNS 106
            ||  |.|||..|. ........:..:|:|...|.:|.|.:.|...|.:.|......|..   |::
  Fly    21 VP--RQRRQIDLTVSAEHDDNDEETELALEAIAGLWSSADSRTKIDGSASLVHRTHGTQSGTGST 83

  Fly   107 RPQ 109
            |.|
  Fly    84 RYQ 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DptBNP_523787.2 Attacin_C <70..120 CDD:397714 12/43 (28%)
CG33493NP_996038.1 None

Return to query results.
Submit another query.