DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: DptA and AttD

Sequence 1:NP_476808.1 Gene:DptA FlyBaseID:FBgn0004240 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_524391.2 Gene:AttD FlyBaseID:FBgn0038530 Length:181 Species:Drosophila melanogaster

Alignment Length:76 Identity:27/77 (35%)
Similarity:34/77 (44%) Gaps:12/77 (16%)


  Fly    38 LNLQGGGGGQSGDG------FGF-AVQ--GHQKVWTSDNGRHEIGLNGGYGQHLGGPY-GNSEPS 92
            ||||.|.|.|:..|      ||. |||  |...::||.:|...:...|....||.||. |.|:  
  Fly   108 LNLQTGTGHQAAVGVTRVPQFGMTAVQASGTANLYTSPSGNLNLNATGSANHHLRGPMRGKSD-- 170

  Fly    93 WKVGSTYTYRF 103
            :..|....|.|
  Fly   171 FGTGVNLRYNF 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DptANP_476808.1 None
AttDNP_524391.2 Attacin_N 1..65 CDD:281725
Attacin_C 67..181 CDD:281726 26/75 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR38333
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.