DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and AIMP1

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_001135887.1 Gene:AIMP1 HGNCID:10648 Length:312 Species:Homo sapiens

Alignment Length:220 Identity:58/221 (26%)
Similarity:88/221 (40%) Gaps:59/221 (27%)


  Fly   814 ATNDAAHSQISAADLEKAVQ--AQADKVRE-LKAST---KDKAIWQP---EVTKL----LDLKKQ 865
            |.|||.        |::..|  |:||::.| ||...   |:|||.|.   |..||    ..|||:
Human     2 ANNDAV--------LKRLEQKGAEADQIIEYLKQQVSLLKEKAILQATLREEKKLRVENAKLKKE 58

  Fly   866 LEEAKKKTATAAA---------PAATPAPSNGSQS---VQDLEKAIQEQGDKVRKLKGSTKDKTV 918
            :||.|::...|..         |:.||..:|...|   :|.........|.| .::||.|.|:  
Human    59 IEELKQELIQAEIQNGVKQIPFPSGTPLHANSMVSENVIQSTAVTTVSSGTK-EQIKGGTGDE-- 120

  Fly   919 WQPEVNILLDLKKQLEAVQKAAKAAPAANAAPAASPAATADAAKVKALEDKIAQQAEKVRTLKAT 983
                       ||..|.::|..:.......:.|.|  |.:....|..|:.:|.    .:.|.:..
Human   121 -----------KKAKEKIEKKGEKKEKKQQSIAGS--ADSKPIDVSRLDLRIG----CIITARKH 168

  Fly   984 GDA-AVWKPEVDILLSLKNELAALT 1007
            .|| :::..|||:     .|:|..|
Human   169 PDADSLYVEEVDV-----GEIAPRT 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029
MetRS_core 255..625 CDD:173907
Anticodon_Ia_Met 634..763 CDD:153411
MetRS_RNA 828..868 CDD:238475 20/53 (38%)
MetRS_RNA 895..938 CDD:238475 9/43 (21%)
MetRS_RNA 966..1009 CDD:238475 11/44 (25%)
AIMP1NP_001135887.1 PRK05431 3..>79 CDD:235461 26/84 (31%)
Required for fibroblast proliferation 6..46 15/48 (31%)
Interaction with HSP90B1. {ECO:0000250} 54..194 38/161 (24%)
Required for endothelial cell death 101..114 2/14 (14%)
Required for endothelial cell migration 114..192 23/100 (23%)
PLN02610 <140..312 CDD:215329 15/61 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.