DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and YARS

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_003671.1 Gene:YARS HGNCID:12840 Length:528 Species:Homo sapiens

Alignment Length:391 Identity:81/392 (21%)
Similarity:146/392 (37%) Gaps:134/392 (34%)


  Fly   674 LALINRELRGYINSM----EKAKLRDGVRHLLAISRHGN---GYMQS----QQPWVLLKGTDDQK 727
            :.::..:|..|:::|    |..:||        :|.:.|   ..::|    .:....:||||.|.
Human    69 VTILFADLHAYLDNMKAPWELLELR--------VSYYENVIKAMLESIGVPLEKLKFIKGTDYQL 125

  Fly   728 TRASTIIGLCVNIAC-------------------LLANLLFP--------YMPTTARTLFGQLNA 765
            ::..|:....::...                   ||:.||:|        |:...|:  ||.::.
Human   126 SKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQALDEEYLKVDAQ--FGGIDQ 188

  Fly   766 KQTPLNAEKPLVTLLLPAGHQIGKPAPLFAK---LEQSFIDELKGKYGGAQATNDAAHSQISAAD 827
            ::....|||.|             ||..::|   |....:..|.|             |::|:::
Human   189 RKIFTFAEKYL-------------PALGYSKRVHLMNPMVPGLTG-------------SKMSSSE 227

  Fly   828 LEKAVQAQADKVRELKASTKDKAIWQPEVTK-----------LLDLKKQ---LEEAK---KKTAT 875
            .|..:.. .|:..::|...| ||..:|...:           |..||.:   |.:.|   .||.|
Human   228 EESKIDL-LDRKEDVKKKLK-KAFCEPGNVENNGVLSFIKHVLFPLKSEFVILRDEKWGGNKTYT 290

  Fly   876 AAAPAATPAPSNGSQSVQDLEK----AIQEQGDKVRKLKGSTKDKTVWQPEVNILLD---LKKQL 933
            |..               ||||    .:...||    ||.|.      :..:|.|||   .|...
Human   291 AYV---------------DLEKDFAAEVVHPGD----LKNSV------EVALNKLLDPIREKFNT 330

  Fly   934 EAVQKAAKAA---PAANAAPAASPAATADAAKVKALEDKIAQQAEKVRTLKATGDA-AVWKPEVD 994
            .|::|.|.||   |:.....|..||..::..:|  :..::..:..|:.|::...|| :::..::|
Human   331 PALKKLASAAYPDPSKQKPMAKGPAKNSEPEEV--IPSRLDIRVGKIITVEKHPDADSLYVEKID 393

  Fly   995 I 995
            :
Human   394 V 394

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 34/179 (19%)
MetRS_core 255..625 CDD:173907
Anticodon_Ia_Met 634..763 CDD:153411 24/127 (19%)
MetRS_RNA 828..868 CDD:238475 11/54 (20%)
MetRS_RNA 895..938 CDD:238475 14/50 (28%)
MetRS_RNA 966..1009 CDD:238475 5/32 (16%)
YARSNP_003671.1 nt_trans 8..328 CDD:320711 66/322 (20%)
'HIGH' region 44..52
'KMSKS' region 222..226 1/4 (25%)
PRK12267 <327..528 CDD:330948 16/71 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.