DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and MES1

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_011780.3 Gene:MES1 SGDID:S000003496 Length:751 Species:Saccharomyces cerevisiae

Alignment Length:828 Identity:355/829 (43%)
Similarity:476/829 (57%) Gaps:110/829 (13%)


  Fly    15 LLMLAKFAKQPVQVQLV-NLNDA---KYKDLLVLPTLELDNG---LR-------LFSPAAIAKYL 65
            |:...|..|.|..:||. ||..|   :|....:.|.::.||.   ||       ||...||.:|:
Yeast     4 LISFDKSKKHPAHLQLANNLKIALALEYASKNLKPEVDNDNAAMELRNTKEPFLLFDANAILRYV 68

  Fly    66 FVG-KGQQRDEWLEWSATLLAPALAH------HMAV-GHKADANALPVLNALVKKLDDKLKATPY 122
            ... :||..|:: :::...|...|.|      |:.| .:||      :.|.|| :|.:.|..|  
Yeast    69 MDDFEGQTSDKY-QFALASLQNLLYHKELPQQHVEVLTNKA------IENYLV-ELKEPLTTT-- 123

  Fly   123 LAGDKPSAADIAIWSLLAPDGTLKGAQNVDNLRDWYGRVKALPEVQEVLAEQPLKDLSFNALQQS 187
                     |:.:::            ||      |....:|  |.....|.|.|  ..||:..:
Yeast   124 ---------DLILFA------------NV------YALNSSL--VHSKFPELPSK--VHNAVALA 157

  Fly   188 NRYGGLHHVPLKRLSLADASKLLVDTTPTVADTVTNEEISAAKAAFTYTA-PKEIKEERTVLPKP 251
            .:     |||                    .|:.:.:.|.|.|.....|. ||:.:    :||||
Yeast   158 KK-----HVP--------------------RDSSSFKNIGAVKIQADLTVKPKDSE----ILPKP 193

  Fly   252 GERNVLITSALPYVNNVPHLGNIIGCVLSADIYARYSRSAGYNTLLICGTDEYGTATENKALAEN 316
            .|||:||||||||||||||||||||.||||||:|||.:...||.|.||||||||||||.|||.|.
Yeast   194 NERNILITSALPYVNNVPHLGNIIGSVLSADIFARYCKGRNYNALFICGTDEYGTATETKALEEG 258

  Fly   317 LTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLKAGYIITESVEQLLCQK 381
            :|||::||||.::|:.:|:||.|||||||||||.:||:|.|..|..:...||:..:|::||.|..
Yeast   259 VTPRQLCDKYHKIHSDVYKWFQIGFDYFGRTTTDKQTEIAQHIFTKLNSNGYLEEQSMKQLYCPV 323

  Fly   382 CDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNATELIRPRCKVCNSAPVLRSSDQLFIDL 446
            .:.:||||:|||.||.  |.|:|||||||||||.|::..|||.||||:.:::|..:.||.:|:.|
Yeast   324 HNSYLADRYVEGECPK--CHYDDARGDQCDKCGALLDPFELINPRCKLDDASPEPKYSDHIFLSL 386

  Fly   447 PKAEPQLKEWVDKS--EGGWTHNAKVITRAWLKEGLKPRCITRDLKWGIPVPHEGFEKKVFYVWF 509
            .|.|.|:.|||:|:  ||.|:.|:|.||::|||:|||||||||||.||.|||.|.::.||.||||
Yeast   387 DKLESQISEWVEKASEEGNWSKNSKTITQSWLKDGLKPRCITRDLVWGTPVPLEKYKDKVLYVWF 451

  Fly   510 DAPFGYVSMTKRYTKEYQQWWQPAKGTDVELFQFMAKDNVPFHSVVWPSVLLAINKGHTLVSHIM 574
            ||..||||:|..||||::|||...:  .|.|:|||.|||||||:||:|...|...:..|::.|:.
Yeast   452 DATIGYVSITSNYTKEWKQWWNNPE--HVSLYQFMGKDNVPFHTVVFPGSQLGTEENWTMLHHLN 514

  Fly   575 ATEYLNYEDGKFSKSRGIGVFGNDAQETGIPADVWRFYLASARPEGQDSSFSWNDLAARNNSELL 639
            .||||.||:||||||||:|||||:||::||...|||:||||.|||..||.|||:|..||||||||
Yeast   515 TTEYLQYENGKFSKSRGVGVFGNNAQDSGISPSVWRYYLASVRPESSDSHFSWDDFVARNNSELL 579

  Fly   640 NNLGNFVNRALVFCEKNFSSTVPGV----ITTQDELVLLALINRELRGYINSMEKAKLRDGVRHL 700
            .||||||||.:.|....::..||..    ::..|.||  ..||..|..|:..||....|.|:...
Yeast   580 ANLGNFVNRLIKFVNAKYNGVVPKFDPKKVSNYDGLV--KDINEILSNYVKEMELGHERRGLEIA 642

  Fly   701 LAISRHGNGYMQSQQPWVLLKGTDDQKTRASTIIGLCVNIACLLANLLFPYMPTTARTLFGQLNA 765
            :::|..||.::|..:....|.....:|:.|...:||  ||...:::::.||||.....:...|||
Yeast   643 MSLSARGNQFLQENKLDNTLFSQSPEKSDAVVAVGL--NIIYAVSSIITPYMPEIGEKINKMLNA 705

  Fly   766 KQTPLNAEKPLVTLLLPAGHQIGKPAPLFAKLEQSFIDELKGKYGGAQ 813
            ....::....|..|   .||.|.|...||.::::..|||.:.||||.|
Yeast   706 PALKIDDRFHLAIL---EGHNINKAEYLFQRIDEKKIDEWRAKYGGQQ 750

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698 43/182 (24%)
GST_N_family 1..65 CDD:238319 20/64 (31%)
GST_C_family 63..164 CDD:295467 21/109 (19%)
PRK12268 254..812 CDD:237029 292/564 (52%)
MetRS_core 255..625 CDD:173907 224/372 (60%)
Anticodon_Ia_Met 634..763 CDD:153411 43/133 (32%)
MetRS_RNA 828..868 CDD:238475
MetRS_RNA 895..938 CDD:238475
MetRS_RNA 966..1009 CDD:238475
MES1NP_011780.3 MetRS-N 11..132 CDD:255464 37/158 (23%)
PRK12267 190..>750 CDD:330948 297/571 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C333229138
eggNOG 1 0.900 E1_COG0143
Hieranoid 1 1.000
Homologene 1 1.000 H90878
Inparanoid 1 1.050 596 1.000 Inparanoid score I131
Isobase 1 0.950 0 Normalized mean entropy S822
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004323
OrthoInspector 1 1.000 T1135543
orthoMCL 1 0.900 OOG5_127626
Panther 1 1.100 LDO PTHR45765
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1449
TreeFam 1 0.960
1312.730

Return to query results.
Submit another query.