DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and MSM1

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_011687.1 Gene:MSM1 SGDID:S000003403 Length:575 Species:Saccharomyces cerevisiae

Alignment Length:584 Identity:135/585 (23%)
Similarity:224/585 (38%) Gaps:144/585 (25%)


  Fly   258 ITSALPYVNNVPHLGNIIGCVLSADIYARYSRSAGYNTLLICGTDEYG----TATENKALAENLT 318
            :|:.:.|.|..||||::...:|| |:|.|:....|..:....||||:|    .|:|:....:   
Yeast    17 VTTPIFYPNAKPHLGHLYSSLLS-DVYHRWQLFKGNLSFFTTGTDEHGLKIQCASESNGFDQ--- 77

  Fly   319 PREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLKAGYIITESVEQLLCQKCD 383
            |::..||.:.....:.:.:||.:..|.|||..:..:.|.:.::..||.|||.....:.......:
Yeast    78 PKKFVDKLYPEFVQLDKIYGINYTRFIRTTDPDHIENVMKLWELCLKNGYIYMGEHKGWYSISDE 142

  Fly   384 RFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNA---TELIRP-------RCKVCNSAPV--L 436
            .|..:..|          .:|.:.|     ||.:|.   .|::..       |..:.|...|  :
Yeast   143 TFYPESKV----------IKDPKND-----GKYLNTESKNEVVYQSETNYFFRLSLFNKKIVDHI 192

  Fly   437 RSSDQLFIDLPKAEPQLKEWVDKSEGGWTHNAKVITRAWLKEGLKPRCITRDLKWGIPVPHEGFE 501
            |.:........|.:..|||    .|.|.|.....|:|.           :..||||||.|::..:
Yeast   193 RKNPDFIFPASKRDQILKE----LETGGTLPDLSISRP-----------SARLKWGIPTPNDPSQ 242

  Fly   502 KKVFYVWFDAPFGYVS--------------MTKR---------------YTKEYQQWWQPAKGTD 537
            |  .||||||...|:|              :..|               |.||.|:         
Yeast   243 K--VYVWFDALCNYLSSIGGIPSILSNATEVVSRHYSDKSNVKGQLLIPYPKEVQR--------- 296

  Fly   538 VELFQFMAKDNVPFHSVVWPSVLLA---------INKGHTLVSHIMATEYLNYEDGKFSKSRGIG 593
             .....:.||...||:|.|||.|||         :..||.|.:.:           |.|||.|..
Yeast   297 -NTIHVIGKDIAKFHTVYWPSFLLAAGLPLPRQIVVHGHWLCNGM-----------KMSKSLGNV 349

  Fly   594 VFGND-AQETGIPADVWRFYLASARPEGQDSSFSWNDLAARNNSELL-NNLGNFVNR-------- 648
            |...| |:..|  ||:.|::|.......:|..|  .:.......||| :..||.:||        
Yeast   350 VDPIDMARYYG--ADIVRWFLLENSKLEEDGDF--QEAKLYETRELLVSKWGNLINRCCGSKFNI 410

  Fly   649 ---ALVFCEK-NFSSTVPGVITTQDELV------LLALINRELRGYINSMEKAKLRDGVRHLLAI 703
               .:.|.:| ||...   .|...:.:|      |..|:|:....:...:...:....:||:.:|
Yeast   411 ERAVMKFSDKANFQFQ---EIFQNEPIVSERIENLAKLLNKSQEVFDEKIAIFQYPQLLRHVWSI 472

  Fly   704 SRHGNGYMQSQQPWVLLKGTDDQKTRASTIIGLCVNIACLLANLLFPYMPTTARTLFGQLNAKQ 767
            ....|..:|:.:||      :.:..:...||.|.:..:.:|:.|....:|:.:::...:::..:
Yeast   473 INDANTLVQNSKPW------ERELDQQDNIIFLAMETSRILSILCQSIIPSLSQSFLDRIDVSK 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 135/585 (23%)
MetRS_core 255..625 CDD:173907 105/422 (25%)
Anticodon_Ia_Met 634..763 CDD:153411 29/148 (20%)
MetRS_RNA 828..868 CDD:238475
MetRS_RNA 895..938 CDD:238475
MetRS_RNA 966..1009 CDD:238475
MSM1NP_011687.1 metG 15..550 CDD:273058 135/585 (23%)
MetRS_core 16..380 CDD:173907 105/422 (25%)
Anticodon_Ia_like 392..526 CDD:299868 27/143 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.