DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and AT4G13780

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_193114.1 Gene:AT4G13780 AraportID:AT4G13780 Length:797 Species:Arabidopsis thaliana

Alignment Length:827 Identity:349/828 (42%)
Similarity:482/828 (58%) Gaps:95/828 (11%)


  Fly   236 TAPKEIKEERTVLPKPGERNVLITSALPYVNNVPHLGNIIGCVLSADIYARYSRSAGYNTLLICG 300
            ::||        ||.||:||:||||||||||||||||||||||||||:||||.|..|||.:.|||
plant     7 SSPK--------LPIPGKRNILITSALPYVNNVPHLGNIIGCVLSADVYARYCRLRGYNAIYICG 63

  Fly   301 TDEYGTATENKALAENLTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLK 365
            |||||||||.|||.||.||:||||||..:|..:|.||||.||.||||:|.|||::.|..|..:..
plant    64 TDEYGTATETKALEENCTPKEICDKYHAIHKEVYDWFGISFDKFGRTSTPEQTEVCQAIFNKLWD 128

  Fly   366 AGYIITESVEQLLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNATELIRPRCKVC 430
            ..::...:::||.|..|.:|||||.|||:||..||.|:.||||||:|||||:|.|||..|:||||
plant   129 NKWLSENTMQQLYCDTCKKFLADRLVEGSCPFEGCNYDSARGDQCEKCGKLLNPTELKDPKCKVC 193

  Fly   431 NSAPVLRSSDQLFIDLPKAEPQLKEWVDKSE--GGWTHNAKVITRAWLKEGLKPRCITRDLKWGI 493
            .:.|.:|.:|.|||:||..:.:|:.::.|:.  |.|:.||...|.|||::||:.||||||||||:
plant   194 QNTPRIRDTDHLFIELPLLKDRLEAYIKKTSVTGSWSQNAIQTTNAWLRDGLRQRCITRDLKWGV 258

  Fly   494 PVPHEGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVELFQFMAKDNVPFHSVVWPS 558
            |||||.::.||||||||||.||||:|..||.|:::||:..:  :|||:|||.|||||||:|::||
plant   259 PVPHEKYKDKVFYVWFDAPIGYVSITSCYTSEWEKWWKNPE--NVELYQFMGKDNVPFHTVMFPS 321

  Fly   559 VLLAINKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQETGIPADVWRFYLASARPEGQDS 623
            ..|...:..||:..|..||||||||||||||:|:||||||.::|.||.:|||:||.:.|||..|:
plant   322 TQLGTEENWTLMKTISVTEYLNYEDGKFSKSKGVGVFGNDVKDTNIPVEVWRYYLLTNRPEVSDT 386

  Fly   624 SFSWNDLAARNNSELLNNLGNFVNRALVFCEK----NFSSTVPGVITTQDELVLLAL---INREL 681
            ||||.||.|:.|.|||:||||||||.|.|..|    .:.|.:|.....:...:..:|   :.:.:
plant   387 SFSWTDLQAKLNGELLSNLGNFVNRVLSFIAKPDNAGYGSVIPDAHDAESHSLTKSLAEKVEKFV 451

  Fly   682 RGYINSMEKAKLRDGVRHLLAISRHGNGYMQSQQPWVLLKGTDDQKTRASTIIGLCVNIACLLAN 746
            ..|:.:|||.||:.|::..:.||..||.|:|:.|.|.|.|   :.|...:.:|.....:..|||.
plant   452 AEYVEAMEKVKLKQGLKTAMLISSEGNYYLQASQFWKLYK---EDKPLCAVVIRTAAGLVHLLAQ 513

  Fly   747 LLFPYMPTTARTLFGQLN-AKQTPLNAEKPLVTL------LLPAGHQIGKPAPLFAKLEQSFIDE 804
            ||.|:||:.:..:|.||| ..|..|:.|:..|.|      :||..|:||.|.|||.:||...:..
plant   514 LLEPFMPSFSCEVFKQLNLPPQFSLSDERGEVLLASRPWDILPPSHRIGTPQPLFKELENDEVAR 578

  Fly   805 LKGKYGGAQATNDAAHSQISAADLEKAVQAQADKVRELKASTKDKAIWQPEVTKLLDLKKQLEEA 869
            .:.|:.|:|:...|.....:.||       |.:|                  |||.|.|||...:
plant   579 YREKFAGSQSDRRARDEAANLAD-------QLNK------------------TKLSDAKKQKASS 618

  Fly   870 KKKTATAAAPAATPAPSNGSQSVQDLEKA-IQEQGDKVRKLKGSTKDKTVWQPEVNI-------- 925
            |........|||.          :::..| :..:..|:.|.:...|...::..|:::        
plant   619 KGGGKPKPQPAAD----------REITMARLDIRVGKIVKAEKHPKADALYVEEIDVGGGEIRTV 673

  Fly   926 ---------LLDLKKQLEAV---QKAAKAAPAANAAPAASPAATADAAKVKALE-DKIAQQAEKV 977
                     |.:::.::..|   .|.||.....:.|...: |:::|.:||:.:| .|.|...|:|
plant   674 VSGLVKYIPLEEMQNRMVCVLCNLKPAKMRDIVSQAMVLA-ASSSDGSKVELVEPPKTANIGERV 737

  Fly   978 RTLKATGD--------AAVWKPEVDILLSLKNELAALTGTPVAGGQG 1016
            ......|:        ..||:..:..|.:.:|.:|.....|.....|
plant   738 TFPGFEGEPDDVLNPKKKVWETLLVDLNTKENLVACYKDVPFTTSAG 784

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 298/574 (52%)
MetRS_core 255..625 CDD:173907 224/372 (60%)
Anticodon_Ia_Met 634..763 CDD:153411 47/136 (35%)
MetRS_RNA 828..868 CDD:238475 9/40 (23%)
MetRS_RNA 895..938 CDD:238475 7/64 (11%)
MetRS_RNA 966..1009 CDD:238475 11/52 (21%)
AT4G13780NP_193114.1 PLN02610 1..797 CDD:215329 349/828 (42%)
MetRS_core 18..388 CDD:173907 224/372 (60%)
Anticodon_Ia_Met 397..530 CDD:153411 47/136 (35%)
tRNA_bind_EMAP-II_like 634..738 CDD:239198 20/105 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 623 1.000 Inparanoid score I198
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D333013at2759
OrthoInspector 1 1.000 T192691
orthoMCL 1 0.900 OOG5_127626
Panther 1 1.100 LDO PTHR45765
Phylome 1 0.910 0.667 Consistency score
76.970

Return to query results.
Submit another query.