DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and mars2

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:XP_021329980.1 Gene:mars2 ZFINID:ZDB-GENE-111201-1 Length:595 Species:Danio rerio

Alignment Length:597 Identity:146/598 (24%)
Similarity:239/598 (40%) Gaps:84/598 (14%)


  Fly   244 ERTVLPKPGERNVLITSALPYVNNVPHLGNIIGCVLSADIYARYSRSAGYNTLLICGTDEYGTAT 308
            :|:..||.    ..||:.:.|||..||:|::...| :||...||.....||:....||||:|...
Zfish    39 DRSQSPKA----YYITTPIFYVNAPPHIGHVYSAV-TADCLHRYKLLQRYNSRFATGTDEHGLKI 98

  Fly   309 ENKALAENLTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLKAGYIITES 373
            :..|.:....|...|.:..|....:::..||.:..:.|||.:.....|:..:..:....||...:
Zfish    99 QQAAGSAGKDPLNFCTEVSESFKHVFQRCGISYTDYIRTTEKRHRQAVEHFWTVLQSKSYIYKGT 163

  Fly   374 VEQLLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNATELIRPRCKVCNSAPVLRS 438
            .|.......:.||.:..|.               |..|..|:.:..:.....:.:..|       
Zfish   164 YEGWYSTPDESFLTETQVT---------------DSTDSEGRRIKVSTESGHKVEWMN------- 206

  Fly   439 SDQLFIDLPKAEPQLKEWVDKSEGGWTHNAKV--ITRAWLK-EGLKPRCITRD---LKWGIPVPH 497
            .|.....|.....||..|: :|........|.  :...||: :.:....::|.   |:|||||| 
Zfish   207 EDNYMFRLSDFHTQLLHWL-RSNPNTIQPVKFQHLVLQWLEDDDIPDLSVSRQKSRLQWGIPVP- 269

  Fly   498 EGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVELFQFMAKDNVPFHSVVWPSVLLA 562
             |..::..|||.||...|:::. .|.:.:.:||.       .:...:.||.:.||::.||:.|||
Zfish   270 -GDPEQTIYVWLDALVNYLTVV-GYPQNHSKWWS-------VVHHVVGKDILKFHAIYWPAFLLA 325

  Fly   563 INKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQETGIPADVWRFYLASARPEGQDSSFSW 627
              .|..|...|....:...|..|.|||.|..:...::.|. ...|..|::|........|..:..
Zfish   326 --AGLALPQKIYVHSHWTVEGKKMSKSIGNVINPLESIEK-FTVDGLRYFLLRQGVPDSDCDYYD 387

  Fly   628 NDLAARNNSELLNNLGNFVNRA------LVFCEKNFSST------VPGVITTQDELVLLALINRE 680
            :.:....||||.:.||..:||.      |......||::      :.|...::|..::.|:  ..
Zfish   388 DKVMKMCNSELADALGGLLNRCTAPSLNLTQVYPRFSNSCFPAVGLSGKAVSEDYRMIEAV--SA 450

  Fly   681 LRGYINS-MEKAKLRDGVRHLLAISRHGNGYMQSQQPWVLLKGTDDQKTRASTIIGLCVNIACL- 743
            |.|.|.. .|...:...:..:.|..|..||::|...||.|.:...:::....||  |.|::.|| 
Zfish   451 LPGIIEQHFENMHVYKALEAIGACVRLTNGFVQRHAPWKLDRNNPEEQQWLDTI--LHVSLECLR 513

  Fly   744 -LANLLFPYMPTTARTLFGQLNAKQTP----------LNAEKPLVTLLLPAGHQIGKP-APLFAK 796
             ...||.|.:|..|..:..:|..  ||          ||..:.....|  .|..:|.. ..||::
Zfish   514 IYGILLQPVVPDLADKILSRLGV--TPEERSWNSLNFLNKFQGRECAL--EGRALGPDLGVLFSR 574

  Fly   797 LEQSFIDELKGK 808
            ||:|   ::|||
Zfish   575 LERS---QIKGK 583

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 143/588 (24%)
MetRS_core 255..625 CDD:173907 90/376 (24%)
Anticodon_Ia_Met 634..763 CDD:153411 37/144 (26%)
MetRS_RNA 828..868 CDD:238475
MetRS_RNA 895..938 CDD:238475
MetRS_RNA 966..1009 CDD:238475
mars2XP_021329980.1 PRK12267 45..594 CDD:330948 144/592 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.