DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and aimp1a

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_001039316.1 Gene:aimp1a ZFINID:ZDB-GENE-060825-144 Length:315 Species:Danio rerio

Alignment Length:234 Identity:52/235 (22%)
Similarity:83/235 (35%) Gaps:95/235 (40%)


  Fly   778 TLLLPAGHQIGKPAPLFAKLEQSFIDELKGKYGGAQATNDAAHSQISAADLEKAVQAQADKVREL 842
            :|...:||     .|...:|||                        .||:.|:.::....:|:.|
Zfish     6 SLFKMSGH-----TPSLMRLEQ------------------------KAAEAEQIIEYLKQQVQLL 41

  Fly   843 KASTKDKAIWQ---PEVTKLL----DLKKQLEEAKKKTATAAAPAATPAPSNGSQSVQDLEKAIQ 900
                |:|||.|   .|..||:    .|||.:||.||                     |.|:|   
Zfish    42 ----KEKAIVQATLKEEKKLMVENAKLKKDIEELKK---------------------QLLDK--- 78

  Fly   901 EQGDKVRKLKGSTKDKTVWQPEVNILLDLKK---QLEAVQKAAKAAPAANAAPAASPAATA---- 958
                  .|::|              ::|:..   .::.|.|...|.|..:|:|:|:...|.    
Zfish    79 ------EKMRG--------------VIDVPSTEFSVQCVSKPTSADPPVSASPSAASTKTPSAKN 123

  Fly   959 --DAAKVKALEDKIAQQAEKVRTLKATGDAAVWKPEVDI 995
              :|.|:||  :|..::.||........||.|....:|:
Zfish   124 NDEAKKMKA--EKKGEKKEKKAAAPPQEDAKVDVSRLDL 160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 7/34 (21%)
MetRS_core 255..625 CDD:173907
Anticodon_Ia_Met 634..763 CDD:153411
MetRS_RNA 828..868 CDD:238475 15/47 (32%)
MetRS_RNA 895..938 CDD:238475 6/46 (13%)
MetRS_RNA 966..1009 CDD:238475 7/31 (23%)
aimp1aNP_001039316.1 ATP-synt_B <5..81 CDD:304375 31/138 (22%)
tRNA_bind_EMAP-II_like 153..255 CDD:239198 2/9 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.