DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and IleRS

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_524840.2 Gene:IleRS FlyBaseID:FBgn0027086 Length:1229 Species:Drosophila melanogaster

Alignment Length:1027 Identity:195/1028 (19%)
Similarity:323/1028 (31%) Gaps:364/1028 (35%)


  Fly   196 VPLKRLSLADASKLLVDTTPTVADTVTNEEISAAKAAFTYTAPKEIKEERTVLPKPGERNVLITS 260
            |.|:.:||.:...|:..|||.   |:.:..........||...:::|.:|..:......:.:..|
  Fly   216 VALEAVSLPNTFFLVWTTTPW---TLPSNFACCVHPTMTYVKVRDVKSDRLFVLAESRLSYVYKS 277

  Fly   261 ALPYVNNVPHLGNIIGCVLSADIYARYSRSA----GYNTLLICGTDEYGTATENKALAENLTPRE 321
            ...|......:|..:..:....::..:::..    .|..|:    |||.|......:        
  Fly   278 ETEYEVKEKFVGKTLKDLHYKPLFPYFAKRGAEVKAYRVLV----DEYVTEDSGTGI-------- 330

  Fly   322 ICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLKAGYIITESVEQLLCQKCDRFL 386
                   :|||         .|||           ::.::..|.|| :||:|.|.|    |....
  Fly   331 -------VHNA---------PYFG-----------EDDYRVCLAAG-LITKSSEVL----CPVDE 363

  Fly   387 ADRFVEGTCPHPGCGYEDARGDQCDK--------CGKLVNATELIR--PRCKVCNSAPVLRSSDQ 441
            |.||........|...:|:     ||        .|.||::.::..  |.|...::..:.::...
  Fly   364 AGRFTNEASDFEGQYVKDS-----DKQIMAALKARGNLVSSGQVKHSYPFCWRSDTPLIYKAVPS 423

  Fly   442 LFIDLPKAEPQLKE------WV-----DKSEGGWTHNAKVITRAWLKEGLKPRCITRDLKWGIPV 495
            .|:.:......|.:      ||     :|..|.|...|    |.|        .|:|:..||.|:
  Fly   424 WFVRVEHMSKNLLDCSSQTYWVPDFVKEKRFGNWLKEA----RDW--------AISRNRYWGTPI 476

  Fly   496 PHEGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVELFQFMAKDNVPFHSVVWPSVL 560
            |          :| .:|.|..::.....|:..:    ..|..||.....:.|::...|.|     
  Fly   477 P----------IW-RSPSGDETVVIGSIKQLAE----LSGVQVEDLHRESIDHIEIPSAV----- 521

  Fly   561 LAINKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQ-ETGIPADVWRFYLASARPEGQDSS 624
                .|:..:..|.......:|.|....::....|.|:.. ....|||    ::|    ||.|.:
  Fly   522 ----PGNPPLRRIAPVFDCWFESGSMPFAQQHFPFENEKDFMNNFPAD----FIA----EGIDQT 574

  Fly   625 FSWNDLAARNNSELLNN--LGNFVNRALVFC---------EKNFSSTVPGVITTQDELVLLALIN 678
            ..|.......::.|.|.  ..|.:...||..         :||:...:..|.....:.:.|.|||
  Fly   575 RGWFYTLLVISTALFNKAPFKNLIASGLVLAADGQKMSKRKKNYPDPMEVVHKYGADALRLYLIN 639

  Fly   679 RELRGYINSMEKAKLR---DGVRHLLA----------------ISRH------GNG-YMQSQQ-- 715
            ..:      :....||   :|||.::.                |.|:      ||| |...::  
  Fly   640 SPV------VRAESLRFKEEGVRDIIKDVFLPWYNAYRFLLQNIVRYEKEDLAGNGQYTYDRERH 698

  Fly   716 -----------PWVL--------LKGTDDQKTRASTIIGLCVNIACLLANLLFPYMPTTARTLFG 761
                       .|:|        ...|:.:..|..|::.........|.|.   |:....|.:.|
  Fly   699 LKNMDKASVIDVWILSFKESLLEFFATEMKMYRLYTVVPRLTKFIDQLTNW---YVRLNRRRIKG 760

  Fly   762 QLNAKQ----------------------TPLNAEKPLVTLLL--PAGHQIGKPAPLFAKLEQSFI 802
            :|.|.|                      ||...|.....|:|  |||           .||.:  
  Fly   761 ELGADQCIQSLDTLYDVLYTMVKMMAPFTPYLTEYIFQRLVLFQPAG-----------TLEHA-- 812

  Fly   803 DELKGKYGGAQATNDAAHSQISAA--------DLEKAV----------QAQADK--------VRE 841
                          |:.|.|:...        |:|::|          :...|:        |.|
  Fly   813 --------------DSVHYQMMPVSQKKFIRNDIERSVALMQSVVELGRVMRDRRTLPVKYPVSE 863

  Fly   842 LKASTKDKAI------WQPEVTKLLDLKK-QLEEAKKK--TATAAAP---AATPAPSNGSQSVQD 894
            :.|..||..|      .|..:...|:::| .|...|:|  ....|.|   |.........::|..
  Fly   864 IIAIHKDSQILEAIKTLQDFILSELNVRKLTLSSDKEKYGVTLRAEPDHKALGQRLKGNFKAVMA 928

  Fly   895 LEKAIQE--------QG-----------DKVR-------KLKGSTKDKTVWQPEVNILLDL---- 929
            ..||:::        ||           |:||       ::.|:.:..:  ..||.:|||:    
  Fly   929 AIKALRDDEIQKQVSQGYFDILDQRIELDEVRIIYCTSEQVGGNFEAHS--DNEVLVLLDMTPNE 991

  Fly   930 --------KKQLEAVQKAAKAA--------------PAANAAPAASPAATADAAKV--------- 963
                    ::.:..|||..|.|              .|.|.|......|.|..|||         
  Fly   992 ELLEEGLAREVINRVQKLKKKAQLIPTDPVLIFHELAADNKAKQEVLEAQAQLAKVLSNYASIIK 1056

  Fly   964 KALEDKIA----QQAEKVRTLKATGDAAVWKPEVDILLSLKNELAALTGTPV 1011
            .|::.:.|    :||.|.|.                   :.:||..|.|.|:
  Fly  1057 TAIKSEFAPYSSEQASKKRL-------------------IASELVDLKGVPL 1089

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 122/666 (18%)
MetRS_core 255..625 CDD:173907 75/396 (19%)
Anticodon_Ia_Met 634..763 CDD:153411 33/187 (18%)
MetRS_RNA 828..868 CDD:238475 13/65 (20%)
MetRS_RNA 895..938 CDD:238475 15/81 (19%)
MetRS_RNA 966..1009 CDD:238475 9/47 (19%)
IleRSNP_524840.2 PLN02882 9..1094 CDD:215477 195/1028 (19%)
IleRS_core 47..>189 CDD:173909
IleRS_core <373..650 CDD:173909 63/332 (19%)
Anticodon_Ia_Ile_ABEc 650..847 CDD:153415 38/227 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92023654
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.