DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and ValRS

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_001260946.1 Gene:ValRS FlyBaseID:FBgn0027079 Length:1055 Species:Drosophila melanogaster

Alignment Length:1103 Identity:205/1104 (19%)
Similarity:319/1104 (29%) Gaps:460/1104 (42%)


  Fly   224 EEISAAKAAFTYTAPKEIKEERTVL----------------------------------PKPGER 254
            :|:..|......|||.|.|:....|                                  |.|..:
  Fly    66 KEVKEAAVYTAQTAPGEKKDLSGALPDAYSPRYVEAQWYSWWEKEGFFTPEYGRASIDAPNPNGK 130

  Fly   255 NVLITSALPYVNNVPHLGNIIGCVLSADIYARYSRSAGYNTLLICGTDEYGTATE---NKAL--A 314
            .|:|... |.|....|||:.:...:. |...||.|..|..||.:.|.|..|.||:   .|.|  .
  Fly   131 FVMIIPP-PNVTGSLHLGHALTNAIE-DAITRYHRMKGRTTLWVPGCDHAGIATQVVVEKLLWRD 193

  Fly   315 ENLTPREI-CDKYFELHNAIYRW--------------FGIGFDY----------FGRTTTQ---- 350
            |.|:..:: .:|:.|   .|:.|              .|..:|:          ..|..|:    
  Fly   194 EKLSRHDLGREKFIE---RIWDWRREKGGRIYEQLKSLGSSYDWTRVAFTMDPKLCRAVTEAFVR 255

  Fly   351 --EQTDI------------VQEAFKDV---------------------------LKAGYIITESV 374
              |:..|            ::.|..|:                           :|..|.:..|.
  Fly   256 LHEEGSIYRSSRLVNWSCTLRSAISDIEVDKVEIPGRTFLSIPGYEDKVEFGVLIKFAYKVEGSD 320

  Fly   375 EQLLCQK-----------------------------------------CDRFLADRFVEG----T 394
            |:::...                                         ||.|:...|..|    |
  Fly   321 EEIIVATTRIETMLGDTAVAVHPQDDRYKHLHGKFVVHPFSTRRLPIVCDEFVDMAFGTGAVKIT 385

  Fly   395 CPHPGCGYEDARGDQCD--------------------------KCGKLV----NATELIRPRCKV 429
            ..|....||  .|.:|:                          :|.|.:    .|..|.|   :.
  Fly   386 PAHDPNDYE--VGKRCNLPFITIFNDDGYIIGDYGEFTGMKRFECRKKILEKLKALNLYR---ET 445

  Fly   430 CNSAPVL----RSSDQLFIDLPKAEPQLK-EW--------VDKSEGGWTHNAKVI----TRAWL- 476
            .|:..|:    ||.|.:       ||.:| :|        ...:|...:...|:|    |:.|. 
  Fly   446 LNNPMVVPICSRSKDVV-------EPLIKPQWYVSCSDMAASATEAVRSGELKIIPEHHTKTWYH 503

  Fly   477 -KEGLKPRCITRDLKWG--IPVPHEGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAK---- 534
             .:|::..|::|.|.||  ||..|..|.        |......|.......:.:|:|..|:    
  Fly   504 WMDGIRDWCVSRQLWWGHRIPAYHVSFT--------DPSLQTGSSAHGSVNDDEQYWIVARSEAE 560

  Fly   535 ---------GTDVELFQFMAKDNV----------PFHSVVWPS---------------------- 558
                     |.|.........::|          ||....||.                      
  Fly   561 ALTKAAERFGVDASKIVLKQDEDVLDTWFSSGIFPFSVFGWPDQTKDLQTFYPTSLLETGHDILF 625

  Fly   559 --VLLAINKGHTLVSHIMATE-YLN--YEDG---KFSKS-----------RGIGVFGNDAQ---- 600
              |...:..|..|:..:...| ||:  ..|.   |.|||           |||.:.|..||    
  Fly   626 FWVARMVFFGQKLLGKLPFKEVYLHPMVRDAHGRKMSKSLGNVIDPMDVIRGITLEGLHAQLVGS 690

  Fly   601 ------------------ETGIP---ADVWRFYLASARPEGQDSSFSWNDLAARNNSELLNNLGN 644
                              ..|||   :|..||.|.:...:.:|.:..                  
  Fly   691 NLDPREIEKAKAGQKQDYPQGIPECGSDALRFALCAYITQARDINLD------------------ 737

  Fly   645 FVNRAL---VFCEKNFSST------VPGVITTQDELVLLALINRELRGYINSMEKAKLRDGVRHL 700
             :||.|   .||.|.:::|      ..|......||...|.|| ::..:|.|          |..
  Fly   738 -INRVLGYRFFCNKLWNATKFALLYFTGSEKFDTELSASAAIN-QMDAWILS----------RLA 790

  Fly   701 LAISRHGNG------------------------YMQSQQPWVLLKGTDDQKTRASTIIGLCVNIA 741
            .||.....|                        |::..:| :...|:::|:|.|...:.:|::..
  Fly   791 AAIEACNTGFESYDFAAATSACYAFWLYDLCDVYLECLKP-IFQSGSEEQQTAARRTLYVCLDYG 854

  Fly   742 CLLANLLFPYMPTTARTLFGQLNAKQTPLNAEKPLVTLLLPAGHQIGKPAPLFAKLEQSFIDELK 806
               ..||.|:||.....|:.:                  ||..:    |||....          
  Fly   855 ---LRLLSPFMPFITEELYQR------------------LPRAN----PAPSICV---------- 884

  Fly   807 GKYGGAQATNDAAHSQISAADLE---KAVQ----AQADKVRELKASTKDKAIWQPEVTKLLDLKK 864
                .:..:|.:..|....:|:|   ||.:    |::|.....|..|:...:....|...: ||:
  Fly   885 ----ASYPSNTSWRSTKIESDVEFVQKAARIIRSARSDYNLPNKVKTEVYIVCTDSVPSEI-LKR 944

  Fly   865 QLEEAKKKTATAAAPAATPAPS-------NGSQSVQDLEKAIQEQGDKVRKLKGSTKDKTVWQPE 922
            ...:....:..:.....:|||.       .|...|..|.|.:.|...::.||:            
  Fly   945 YASDLATISYCSNVVFDSPAPQGCAILTVTGQCEVHLLLKGLVEADKEIAKLQ------------ 997

  Fly   923 VNILLDLKKQLEAVQKAAKAAPAANAAPAAS--PAATADAAKVKALEDK--IAQQAEKVRTLK 981
                   ||..:.||...|...|..||..|:  ||...:|.:.|..|.:  |.:.|..:.|||
  Fly   998 -------KKSDQLVQTVGKLTQAIQAADYATKVPAEVQEANETKLCESRAEIERIAAAIETLK 1053

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 153/851 (18%)
MetRS_core 255..625 CDD:173907 116/630 (18%)
Anticodon_Ia_Met 634..763 CDD:153411 32/162 (20%)
MetRS_RNA 828..868 CDD:238475 10/47 (21%)
MetRS_RNA 895..938 CDD:238475 9/43 (21%)
MetRS_RNA 966..1009 CDD:238475 6/19 (32%)
ValRSNP_001260946.1 PTZ00419 80..1053 CDD:240411 200/1088 (18%)
ValRS_core 129..736 CDD:185677 116/632 (18%)
tRNA-synt_1_2 307..436 CDD:290334 17/131 (13%)
Anticodon_Ia_Val 736..873 CDD:153416 32/189 (17%)
Val_tRNA-synt_C 978..1053 CDD:287436 24/94 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92149608
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.