DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and yars

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_001004987.1 Gene:yars XenbaseID:XB-GENE-491608 Length:528 Species:Xenopus tropicalis

Alignment Length:249 Identity:56/250 (22%)
Similarity:90/250 (36%) Gaps:98/250 (39%)


  Fly   743 LLANLLFP--------YMPTTARTLFGQLNAKQTPLNAEK---------------PLVTLLLPAG 784
            ||:.||:|        |:...|:  ||.::.::....|||               |:|..|..|.
 Frog   160 LLSGLLYPGLQALDEEYLKVDAQ--FGGVDQRKIFTFAEKYLPALGYAKRIHLMNPMVPGLTGAK 222

  Fly   785 HQ----------IGKPAPLFAKLEQSFID------------------ELKG--------KYGGAQ 813
            ..          :..||.:..||:::|.:                  .||.        |:||.:
 Frog   223 MSSSEEESKIDLLDSPADVKKKLKKAFCEPGNIENNGVLSFVRHVLFPLKSEFVVLRDEKFGGNK 287

  Fly   814 ATNDAAHSQISAADLEKAVQAQADKVRELKASTKDKAIWQPEVTKLLD-LKKQLEEAK-KKTATA 876
            ...|       ...|||....|.....:||||. :||:     .|||| ::::....: ||.:..
 Frog   288 TYTD-------FETLEKDFTEQLVHPGDLKASV-EKAL-----NKLLDPIREKFNSPEMKKLSND 339

  Fly   877 AAPAATPAPSNGSQSVQDLEKAIQEQGDKVRKLKGSTKDKTVWQPEVNILLDLK 930
            |.|.|:.            :|.:.         |||||:....:.:.: ||||:
 Frog   340 AYPGASK------------QKTVP---------KGSTKNSGPEEIDPS-LLDLR 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 26/128 (20%)
MetRS_core 255..625 CDD:173907
Anticodon_Ia_Met 634..763 CDD:153411 9/28 (32%)
MetRS_RNA 828..868 CDD:238475 14/41 (34%)
MetRS_RNA 895..938 CDD:238475 10/37 (27%)
MetRS_RNA 966..1009 CDD:238475
yarsNP_001004987.1 nt_trans 8..337 CDD:320711 43/192 (22%)
'HIGH' region. {ECO:0000250} 44..52
'KMSKS' region. {ECO:0000250} 222..226 0/4 (0%)
PRK12267 <271..528 CDD:330948 35/137 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.