DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and MARS

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_004981.2 Gene:MARS HGNCID:6898 Length:900 Species:Homo sapiens

Alignment Length:917 Identity:452/918 (49%)
Similarity:589/918 (64%) Gaps:65/918 (7%)


  Fly     1 MIIYTNDGNPLGLQLLMLAKFAKQPVQVQLVNLNDAKYKDLLV-------LPTLELDNGLRLFSP 58
            |.::.:||.|..|.:|..|..|:...:|.:..:..   :|.:|       :|.|:||:|..|||.
Human     1 MRLFVSDGVPGCLPVLAAAGRARGRAEVLISTVGP---EDCVVPFLTRPKVPVLQLDSGNYLFST 62

  Fly    59 AAIAKYLFVGKGQQRD----EWLEWSATLLAPALA---HHMAVGHKADANALPVLNALVKKLDDK 116
            :||.:|.|:..|.::|    :||||.||.|.|||:   :::.|..|...:.|..:...:..:|..
Human    63 SAICRYFFLLSGWEQDDLTNQWLEWEATELQPALSAALYYLVVQGKKGEDVLGSVRRALTHIDHS 127

  Fly   117 L--KATPYLAGDKPSAADIAIWSLLAPDGTLKG----AQNVDNLRDWYGRVKALPEVQEVLAEQP 175
            |  :..|:|||:..|.|||.:|..|.|  .|:.    .:.:..|..|:         |.:..::|
Human   128 LSRQNCPFLAGETESLADIVLWGALYP--LLQDPAYLPEELSALHSWF---------QTLSTQEP 181

  Fly   176 LKDLSFNALQQSNRYGGLHHVPL--KRLSLADASKLLVDTTPTVAD--TVTNEEISAAKAAF--- 233
            .:..:...|:|.   |.|...|.  |:...:.|....|...|...:  |::.|||:.|..|:   
Human   182 CQRAAETVLKQQ---GVLALRPYLQKQPQPSPAEGRAVTNEPEEEELATLSEEEIAMAVTAWEKG 243

  Fly   234 TYTAPKEIKEERTVLPKPGERNVLITSALPYVNNVPHLGNIIGCVLSADIYARYSRSAGYNTLLI 298
            ..:.|....::..|||..|||||||||||||||||||||||||||||||::|||||...:|||.:
Human   244 LESLPPLRPQQNPVLPVAGERNVLITSALPYVNNVPHLGNIIGCVLSADVFARYSRLRQWNTLYL 308

  Fly   299 CGTDEYGTATENKALAENLTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDV 363
            |||||||||||.|||.|.|||:||||||..:|..|||||.|.||.||||||.:||.|.|:.|:.:
Human   309 CGTDEYGTATETKALEEGLTPQEICDKYHIIHADIYRWFNISFDIFGRTTTPQQTKITQDIFQQL 373

  Fly   364 LKAGYIITESVEQLLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNATELIRPRCK 428
            ||.|:::.::||||.|:.|.||||||||||.||.  ||||:||||||||||||:||.||.:|:||
Human   374 LKRGFVLQDTVEQLRCEHCARFLADRFVEGVCPF--CGYEEARGDQCDKCGKLINAVELKKPQCK 436

  Fly   429 VCNSAPVLRSSDQLFIDLPKAEPQLKEWVDKSEGG--WTHNAKVITRAWLKEGLKPRCITRDLKW 491
            ||.|.||::||..||:||||.|.:|:||:.::..|  ||.||:.|||:||::|||||||||||||
Human   437 VCRSCPVVQSSQHLFLDLPKLEKRLEEWLGRTLPGSDWTPNAQFITRSWLRDGLKPRCITRDLKW 501

  Fly   492 GIPVPHEGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVELFQFMAKDNVPFHSVVW 556
            |.|||.||||.|||||||||..||:|:|..||.::::||:..:  .|:|:||||||||||||:|:
Human   502 GTPVPLEGFEDKVFYVWFDATIGYLSITANYTDQWERWWKNPE--QVDLYQFMAKDNVPFHSLVF 564

  Fly   557 PSVLLAINKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQETGIPADVWRFYLASARPEGQ 621
            |...|.....:|||||::|||||||||||||||||:||||:.||:||||||:|||||...|||||
Human   565 PCSALGAEDNYTLVSHLIATEYLNYEDGKFSKSRGVGVFGDMAQDTGIPADIWRFYLLYIRPEGQ 629

  Fly   622 DSSFSWNDLAARNNSELLNNLGNFVNRALVFCEKNFSSTVPGVITTQDELVLLALINRELRGYIN 686
            ||:|||.||..:||||||||||||:|||.:|..|.|...||.::.|.|:..|||.:..||:.|..
Human   630 DSAFSWTDLLLKNNSELLNNLGNFINRAGMFVSKFFGGYVPEMVLTPDDQRLLAHVTLELQHYHQ 694

  Fly   687 SMEKAKLRDGVRHLLAISRHGNGYMQSQQPWVLLKGTDDQKTRASTIIGLCVNIACLLANLLFPY 751
            .:||.::||.:|.:|.||||||.|:|..:||..:||::..:.||.|:.||.||||.||:.:|.||
Human   695 LLEKVRIRDALRSILTISRHGNQYIQVNEPWKRIKGSEADRQRAGTVTGLAVNIAALLSVMLQPY 759

  Fly   752 MPTTARTLFGQLNAKQTPLNAEKPLVT---LLLPAGHQIGKPAPLFAKLEQSFIDELKGKYGGAQ 813
            |||.:.|:..||   |.|..|...|:|   ..||||||||..:|||.|||...|:.|:.::||.|
Human   760 MPTVSATIQAQL---QLPPPACSILLTNFLCTLPAGHQIGTVSPLFQKLENDQIESLRQRFGGGQ 821

  Fly   814 ATNDAAHSQISAADLEKAVQAQA---------DKVRELKASTKDKAIWQPEVTKLLDLKKQLEEA 869
            |......:.:......|..|.||         :.||||||...||.....||.|||||||||..|
Human   822 AKTSPKPAVVETVTTAKPQQIQALMDEVTKQGNIVRELKAQKADKNEVAAEVAKLLDLKKQLAVA 886

  Fly   870 KKKTATA 876
            :.|...|
Human   887 EGKPPEA 893

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698 55/194 (28%)
GST_N_family 1..65 CDD:238319 22/71 (31%)
GST_C_family 63..164 CDD:295467 33/114 (29%)
PRK12268 254..812 CDD:237029 347/563 (62%)
MetRS_core 255..625 CDD:173907 252/372 (68%)
Anticodon_Ia_Met 634..763 CDD:153411 65/129 (50%)
MetRS_RNA 828..868 CDD:238475 23/49 (47%)
MetRS_RNA 895..938 CDD:238475
MetRS_RNA 966..1009 CDD:238475
MARSNP_004981.2 Thioredoxin_like <27..68 CDD:294274 13/44 (30%)
GstA <47..189 CDD:223698 45/153 (29%)
GST_C_MetRS_N 77..179 CDD:198340 31/113 (27%)
PRK12268 264..819 CDD:237029 346/562 (62%)
MetRS_core 265..633 CDD:173907 252/372 (68%)
'HIGH' region 273..283 10/10 (100%)
'KMSKS' region 593..597 4/4 (100%)
Anticodon_Ia_Met 642..771 CDD:153411 65/129 (50%)
MetRS_RNA 845..889 CDD:238475 20/44 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Hieranoid 1 1.000
Homologene 1 1.000 H90878
Inparanoid 1 1.050 815 1.000 Inparanoid score I472
Isobase 1 0.950 0 Normalized mean entropy S822
OMA 1 1.010
OrthoDB 1 1.010 D279987at33208
OrthoFinder 1 1.000 FOG0004323
OrthoInspector 1 1.000 T1072274
orthoMCL 1 0.900 OOG5_127626
Panther 1 1.100 LDO PTHR45765
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.