DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and IleRS-m

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_648837.2 Gene:IleRS-m FlyBaseID:FBgn0036569 Length:941 Species:Drosophila melanogaster

Alignment Length:1151 Identity:209/1152 (18%)
Similarity:352/1152 (31%) Gaps:418/1152 (36%)


  Fly     2 IIYTNDGNPLGLQLLMLAKFAKQPVQVQLVNLNDAKYKDLLVLPTLELDNGLRLFSPAAIAKYLF 66
            |.|...||     .|...|.||:..:         ||.|.:.||..:..|.|.            
  Fly     4 IFYFRVGN-----RLYSMKAAKKDAK---------KYTDTINLPKTKFPNRLT------------ 42

  Fly    67 VGKGQQRDEWLEWSATLLAPALAHHMAVGHKADANALPVLNALVKKLDDKLKATPYLAGDKPSAA 131
            ..|.::::..:          |.:.:||.:....          ::|.:|.|.| ::..|.|..|
  Fly    43 AAKREEQERLV----------LENKIAVSYAYQE----------QRLAEKGKPT-FVLHDGPPYA 86

  Fly   132 DIAIWSLLAPDGTLKGAQNVDNLRDWYGRVKALPEVQEVLAEQPLKDLSFNALQQSNRYG----- 191
                      :|.|.....|:.:                     |||::   |:|...:|     
  Fly    87 ----------NGQLHMGHAVNKI---------------------LKDIT---LRQRVAHGQRVNY 117

  Fly   192 ----GLHHVPLKRLSLADASKLLVDTTPTVADTVTNEEISAAKAAFTYTAPKEIKEE-------- 244
                ..|.:|::           :..|.| |...:.:||.....||.:.|.|..|||        
  Fly   118 IPGWDCHGLPIE-----------LKATST-APGQSAQEIRQKSRAFAWEAIKSQKEEFSSWGILA 170

  Fly   245 ---------------------------------RTVLP---KPGERNVLITSALPYVNNVPHLGN 273
                                             |.:.|   .|..|..|..:.|.|..|  |   
  Fly   171 NWQKDNIYMTFQPEFIVNQLEMFYNLYEKGLVYRDLKPVYWSPSSRTALAEAELEYDAN--H--- 230

  Fly   274 IIGCVLSADIYARYS-RSAGYNT------LLICGTDEYGTATENKALAENLTPREIC-------- 323
                 :|..:|.|:: ..:.::.      .|:..|..: |...|:|:..|.:...:.        
  Fly   231 -----ISPSVYVRFALNPSSFDVKDKQIYALVWTTTPW-TLPSNQAICYNASLEYVIVRLSDRNQ 289

  Fly   324 DKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLK----------------------- 365
            |:.:.:.:|:...|        ...||.:.:|||....::|.                       
  Fly   290 DELYLMASALMADF--------EANTQLKCEIVQHLSGELLSKLSYNHPIDKEQSNLPFFDASHV 346

  Fly   366 -----AGYIITE----------SVEQLLCQKCDRFLADRFV--EGTCPHPGCGYEDARGDQ-CDK 412
                 .|.:.|.          |:.|.:..||       ||  |||.......:  .||.. .|:
  Fly   347 QDSKGTGLVHTAPAHGPEDFLVSLTQKIPVKC-------FVNEEGTYTKEAPDF--LRGKSVLDQ 402

  Fly   413 CGKLV--NATELIRPRCKVCNSAP---------VLRSSDQLFIDLPKAEPQLKEWVDKSEGGWTH 466
            ...||  ...|.:....|:.:|.|         ::|:|:|.||:..|.:....:.:::.|.....
  Fly   403 GNSLVLDRIAEDVVHSSKLEHSYPIDWRTKKPVIIRASEQWFINTEKLKTPAADALEQVEIYPRA 467

  Fly   467 NAKVITRAWLKEGLKPR---CITRDLKWGIPVPHEGFEKKVFY-------VWFDAPFGYVSMTKR 521
            ||:...:|.|.: |:.|   ||:|...||:|:|       |.|       |...|...::....|
  Fly   468 NAEASKKALLTQ-LQKRPYWCISRQRAWGVPIP-------VLYSRESGKVVLNSALIEHLCNLLR 524

  Fly   522 YTKEYQQWWQPAKGTDVELFQFMAKDNVPFHSVVWPSVLLAINKGHTLVSHIMATEYLN--YEDG 584
            .......||..:           .::.||.|        |.....|.....:..|:.|:  ::.|
  Fly   525 KEGSIDFWWVKS-----------VEELVPEH--------LLRELHHEAKDLVKGTDILDIWFDSG 570

  Fly   585 KFSKSRGIGVFGNDAQETGIPADVWRFYLASARPEGQDSSFSW------NDLAAR---------- 633
                |....|.|.|.             :|....||.|....|      ..:|||          
  Fly   571 ----STWSAVLGKDK-------------IADLYLEGYDQFTGWFQSSLLMSIAARECAPYKALFV 618

  Fly   634 -------NNSELLNNLGNFVNRALVFCEKNFSS-----------TVPGVITTQDELVLLALIN-- 678
                   ...::..:|||.::...:  .|.:.:           |....||..|:|:..|..|  
  Fly   619 HGFTVDEKGYKMSKSLGNVISPKQI--TKKYGTDALRWWVASHGTQHMSITVSDKLLQQAAENLC 681

  Fly   679 ------RELRGYINSMEKAK--LRDGVRHLLAISRHGNGYMQSQQPWVLLKGTDD-----QKTRA 730
                  |.|:|.|...:..:  :|...:..|      |.|:.||    |::...:     |....
  Fly   682 KIRGTMRYLKGVIGEKQSGEKLIRTSDKSYL------NRYLLSQ----LVEFESEVEKLYQAYEY 736

  Fly   731 STIIGLCVNIACLLANLLFPYMPTTARTLFGQ----LNAKQTPLNAEKPLVTLLLPAGHQIGKPA 791
            :.::....|......:.::.:: ...|...|.    |..:||..:..:.|...|.|.       .
  Fly   737 NRVVACVQNFIANQVSAVYVHL-IKDRLYCGDDHELLAIRQTLTHCYQQLCKSLWPI-------V 793

  Fly   792 PLFAKLEQSFIDELKGKYGGAQATNDAAHSQISAADLE-------KAVQAQADKVRELKASTKDK 849
            |...:...|:.|          .|..|.|.||...:.|       :.:.|..|..|.:.....|.
  Fly   794 PFLVEESWSYYD----------TTGGAFHEQIVQTNPEWQDTKATEVINAAFDVKRLINQQAGDV 848

  Fly   850 AIWQPEVT------KLLDLKKQLEEAKKKTATAAAPAATPAPSNGSQSVQDLEKAIQEQGDKVRK 908
            ..|...||      ..|||.::|.                :|...|.|..:|.:.:|.  ..|..
  Fly   849 NTWHLAVTIKGKERSQLDLLRELH----------------SPLGESVSNSELCEILQV--GSVTL 895

  Fly   909 LKGSTKDKTVWQPEVNILL-------DLKKQLEAVQKAAKAAPAAN 947
            |:....|..:...::.|.|       .|:.:.:..|:.:....|.|
  Fly   896 LQSHNSDLDIALSKLQISLCPRCRRYGLEDEQKTCQRCSDVMEAKN 941

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698 29/173 (17%)
GST_N_family 1..65 CDD:238319 15/63 (24%)
GST_C_family 63..164 CDD:295467 14/101 (14%)
PRK12268 254..812 CDD:237029 126/690 (18%)
MetRS_core 255..625 CDD:173907 86/449 (19%)
Anticodon_Ia_Met 634..763 CDD:153411 26/159 (16%)
MetRS_RNA 828..868 CDD:238475 12/53 (23%)
MetRS_RNA 895..938 CDD:238475 9/50 (18%)
MetRS_RNA 966..1009 CDD:238475
IleRS-mNP_648837.2 ileS 26..938 CDD:235588 198/1111 (18%)
nt_trans 75..>211 CDD:294020 29/183 (16%)
nt_trans <434..658 CDD:294020 51/270 (19%)
Anticodon_Ia_Ile_BEm 668..842 CDD:153414 37/202 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92107378
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.