DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and LeuRS-m

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_647932.1 Gene:LeuRS-m FlyBaseID:FBgn0027085 Length:869 Species:Drosophila melanogaster

Alignment Length:931 Identity:187/932 (20%)
Similarity:295/932 (32%) Gaps:345/932 (37%)


  Fly    75 EWLEWSATLLAPALAHHMAVGHKADANALPVLNALVKKLDDKLKAT--PYLAGDKPSAADIAIWS 137
            ::.:|:..|......|.:|..::|..|..||...::  .|:::.|.  .:.:|.|.....:..|.
  Fly   160 KYYKWTQHLFLMLHRHGLAYQNEALVNWDPVDKTVL--ADEQVDANGCSWRSGAKVEKKLLRQWF 222

  Fly   138 LLA-----------PDGTLKGAQNVDNL-RDWYGR--------VKALPEVQEVLAEQP--LKDLS 180
            :..           .|.||:..:::.|| |.|.|.        :.:...:..|....|  |||..
  Fly   223 IRTSAYAKQLLDGLEDPTLRDWRDIINLQRHWIGECDGYAFNLLTSASGLLRVWTTHPEHLKDPH 287

  Fly   181 FNALQQSNRYGGLHHVPLKRLSLADASKLLVDTTPTVADTVTNEEISAAKAAFTYTAPKEIKEER 245
            ...:.:||     ||  |.:|..||:                   :|||......|.|....:|.
  Fly   288 AFLVLRSN-----HH--LSKLKGADS-------------------LSAANPFAGTTMPVVFSDEV 326

  Fly   246 TVLPKPGERNVLITSALPYVNNVPHLGNIIGCVLSADIYARYSRSAGYNTLLICGTDEYGTA-TE 309
            |..||                              :|:|.......|.:..|   .|.||.| |.
  Fly   327 TFPPK------------------------------SDVYLAAPSFRGEDKDL---WDSYGLAFTS 358

  Fly   310 NKALAENLTPREICDKYFELHNAIYRWFGIGFDYFGRTTTQEQTDIVQEAFKDVLKA-------G 367
            |....|:|:|.              .|                    :...|:||:|       |
  Fly   359 NGKDEESLSPA--------------NW--------------------EMLRKEVLQAATRLNVGG 389

  Fly   368 YIITESVEQLL---------------CQKC---------------------DRFLADRFVEGTCP 396
            |.::..::..|               ||||                     :.||.|      ||
  Fly   390 YRVSSKLKDWLISRQRYWGTPIPIVHCQKCGAVPVPEEQLPVSLPPKDSPKEAFLCD------CP 448

  Fly   397 HPGCGYEDARGDQCDKCGKLVNATELIRPRCKVCNSAPVLR-----SSDQLFIDLPKAEPQLKEW 456
            .  ||.:||| .:.|.....|:            :|...||     :|:::| |....:..:.  
  Fly   449 K--CGEKDAR-RETDTMDTFVD------------SSWYYLRYLDAQNSERIF-DTALTKKFMP-- 495

  Fly   457 VDKSEGGWTH------NAKVITRAWLKEGLKPRC--ITRDLKWGIPVPHEGFEKKVFYVWFDAPF 513
            ||...||..|      .|:.|.......||.|..  .:|.|..|: |....|.            
  Fly   496 VDLYIGGKEHAVLHLYYARFINHFLHSCGLSPTSEPFSRLLVQGM-VMGRSFR------------ 547

  Fly   514 GYVSMTKRYTKEYQQWWQPAKGTDVELFQFMAKDNVPFHSVVWPSVLLAINKGHTLVSHIMATEY 578
              |..:.||..|          |:||:..  ||.|            .|:.| .|....:|..| 
  Fly   548 --VKGSGRYVPE----------TEVEIVN--AKKN------------QAVLK-ETKEPVVMTWE- 584

  Fly   579 LNYEDGKFSKSRGIGV--------FGNDAQETGIPADV-------WRFYLASARPEG-------- 620
                  |.|||:..||        :|.|.....|.|||       |    :||...|        
  Fly   585 ------KMSKSKLNGVEPSDMFNEYGTDTTRLIILADVAPTSHRNW----SSATFPGILNWQKRL 639

  Fly   621 ----QDSSFSWNDLAARNNSELLNNLGNFV-NRALVFCEKNFSSTVPGVITTQDELVLLALINRE 680
                ||...:..|..|   |:::.....|: ..|.:|..:||  .|.|..........|::...:
  Fly   640 WLTLQDFQQAREDQTA---SDVVPTSEEFLAEDAKLFDARNF--YVKGATFNYRHAQQLSVAISK 699

  Fly   681 LRGYINSMEKAKLRDGVRHLLAISRHGNGYMQSQQPWVLLKGTDDQKTRASTIIGLCVNIACLLA 745
            ::|..||     ||...:|:|   |||..:               ::..|:.||           
  Fly   700 MQGLTNS-----LRRTPKHVL---RHGKQF---------------ERALAAQII----------- 730

  Fly   746 NLLFPYMPTTARTLFGQLNAKQTPLNAEKPLVTLLLPAGHQIGKPAPLFAK----LEQSFIDELK 806
             :|.|..|..|..|:.:..|....||          ||..::.....:.|:    ::.::..:|.
  Fly   731 -MLAPMAPHFASELWSKFVAIPGRLN----------PASQELQWSEDVLAQRWPDIDPAYNLDLS 784

  Fly   807 GKYGG-------AQAT--NDAAHSQISAADLEKAVQAQADKVRELKASTKDKAIWQPEVTKLLDL 862
            .|..|       .|.|  :...||  .|.|:....::....:.:.|..|.:..:: |.:..:|::
  Fly   785 IKVNGFENCVIKVQRTHLDKVTHS--DALDIAFNTESVTSYLIDKKIRTTNFVLY-PGIEAILNI 846

  Fly   863 KKQLEEAKKKTATAAAPAATP 883
            .....:.|:|..|.....|.|
  Fly   847 YVDKAKMKQKPPTTDDAEAQP 867

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698 22/122 (18%)
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467 21/111 (19%)
PRK12268 254..812 CDD:237029 129/654 (20%)
MetRS_core 255..625 CDD:173907 91/454 (20%)
Anticodon_Ia_Met 634..763 CDD:153411 27/130 (21%)
MetRS_RNA 828..868 CDD:238475 4/40 (10%)
MetRS_RNA 895..938 CDD:238475
MetRS_RNA 966..1009 CDD:238475
LeuRS-mNP_647932.1 leuS 40..848 CDD:234743 182/911 (20%)
LeuRS_core 63..624 CDD:173906 128/630 (20%)
Anticodon_Ia_like 624..747 CDD:299868 35/167 (21%)
Anticodon_Ia_like <723..799 CDD:299868 18/98 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92053587
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.