DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MetRS and AIMP1

Sequence 1:NP_611382.1 Gene:MetRS FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster
Sequence 2:NP_610426.2 Gene:AIMP1 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster

Alignment Length:207 Identity:42/208 (20%)
Similarity:72/208 (35%) Gaps:70/208 (34%)


  Fly   788 GKPAPLFAKLEQSFID--ELKGKYGGAQATNDAAHSQISAADLEKAVQAQADKVRELKASTK--D 848
            |:....||:.:::..|  ::......|:|..::..::||....:...:.:.:.::|..|..|  :
  Fly    17 GQNCSKFARNKRTMADLQQIASNNERAEALINSIEAEISGIQQQLVERQKQELIKENAALAKEVE 81

  Fly   849 KAIWQPEVTKLLDLKKQL------------------EEAKKKTATAAAPAATPAPSNGSQSVQDL 895
            .|:.|....:|.:.|||:                  .||...||..||||..||           
  Fly    82 AALAQLVQLELRNGKKQIPVPGARGFCTSAAPVVMPAEAGPATAAPAAPAPKPA----------- 135

  Fly   896 EKAIQEQGDKVRKLKGSTKDKTVWQPEVNILLDLKKQLEAVQKAAKAAPAANAAPAASPAATADA 960
             |..:|:..|.:|                                   |||. .|||:|.|..|.
  Fly   136 -KEPKEKKSKEKK-----------------------------------PAAE-KPAAAPEAPVDV 163

  Fly   961 AKVKALEDKIAQ 972
            .::.....||.:
  Fly   164 GRLDLRVGKIVE 175

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 4/26 (15%)
MetRS_core 255..625 CDD:173907
Anticodon_Ia_Met 634..763 CDD:153411
MetRS_RNA 828..868 CDD:238475 9/60 (15%)
MetRS_RNA 895..938 CDD:238475 4/43 (9%)
MetRS_RNA 966..1009 CDD:238475 2/8 (25%)
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 3/16 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0143
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.